DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and cutl-1

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_506321.3 Gene:cutl-1 WormBaseID:WBGene00009979 Length:399 Species:Caenorhabditis elegans

Alignment Length:404 Identity:86/405 (21%)
Similarity:153/405 (38%) Gaps:90/405 (22%)


  Fly   189 VPYENSKWQEEYWDQEYAGHQHQHNGTRVQHIEAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPD 253
            ||.:||.:.:                     ::.||....:.::|.....|.|:::...:|.:..
 Worm    49 VPIQNSLYGD---------------------VQVECDSRTISVQIKTEKPFVGVIFVKDFASEEV 92

  Fly   254 CMYINGSGRDYYEFYIQLNRCGTLGKNSLQEESRKNPTNF-MWNTVTVQYNPLIEEEYDEHFKVT 317
            |. ..|:||......|::..||.|.:..|      ||... :..|:|:.::|....:.|..:.:.
 Worm    93 CT-SRGTGRLSAFLEIEIGLCGALRQRVL------NPKGLAVRTTITISFHPYFITKVDRTYNLL 150

  Fly   318 CEYGYDFWKTVTFPFLDVEVATGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLT--LI 380
            |.| .:...||.......|::|.:..| .|:.|.|..:|.:|         ||  .|:|:.  ||
 Worm   151 CLY-RESQVTVANNISVDEISTISYNV-NLTMPTCTYQILSG---------GP--FGEPVEFGLI 202

  Fly   381 ---IYMR-----SKYDGFDIVVNDCYAHNGANKRIQLIDQHGCPVDDKLISRFRGSWSDSGVYET 437
               :|.:     .|.|.|.:||:.|...:|..:...|||.:||.:|..|:|......:.....|.
 Worm   203 GQQVYHQWKCDNDKEDSFCMVVHTCSVDDGRGETSFLIDSNGCSIDKFLLSNLEYPGNLLAGQEA 267

  Fly   438 QVYAYMKTFRFTGSPALYIECDVRMCHGRCPSQPCHWRNLKAVTKRDTSNMTATNISIPPLSAD- 501
            .||      :|....||:.:|.:.:. .:.|.|.|                      :.|:..| 
 Worm   268 HVY------KFADRDALFFQCQISIT-VKEPDQEC----------------------VRPICEDV 303

  Fly   502 -GEGLTTESPTANSLSENVNLFQSLRVLQEGETDGDDVYAHRQTKPLSPHQTCLKTSTFSALTAG 565
             |.|.....|.....|:...:..:.|. :..||..|:.....:|:....:...::|::...:.: 
 Worm   304 EGGGAPVVGPPPYGFSQKTQVSFNQRA-KRSETSLDEQITDVRTRFSVSYHFDIQTNSIEIIES- 366

  Fly   566 CSAVLCVLTVTLFI 579
                 |||..|:.|
 Worm   367 -----CVLLSTMSI 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 65/261 (25%)
Zona_pellucida <371..472 CDD:278526 29/111 (26%)
cutl-1NP_506321.3 ZP 62..300 CDD:214579 66/287 (23%)
Zona_pellucida <201..300 CDD:278526 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T374741
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.