DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15020 and cutl-7

DIOPT Version :10

Sequence 1:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001361852.1 Gene:cutl-7 / 186153 WormBaseID:WBGene00009961 Length:535 Species:Caenorhabditis elegans


Alignment Length:87 Identity:24/87 - (27%)
Similarity:35/87 - (40%) Gaps:19/87 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VNVGASSQSQLTKMVKKKPNQSRHLLPSRLSSPSSVPHFVPSAVSRSAKVHGFFASKLG--NTNL 76
            |:..|||.......|...||.|....| :||.|     |.|   .||.|.:...:.:..  |:..
 Worm     6 VSTSASSLRFTAGFVSASPNGSSFDSP-KLSLP-----FEP---LRSRKTNKLVSDRKNWKNSTP 61

  Fly    77 KLKF-GNVMESRAGFFSSELPS 97
            |..: ||:       ::.|:||
 Worm    62 KAVYSGNL-------WTPEIPS 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579
cutl-7NP_001361852.1 ZP 36..278 CDD:214579 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.