DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15020 and cutl-7

DIOPT Version :9

Sequence 1:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001361852.1 Gene:cutl-7 / 186153 WormBaseID:WBGene00009961 Length:535 Species:Caenorhabditis elegans


Alignment Length:373 Identity:76/373 - (20%)
Similarity:137/373 - (36%) Gaps:98/373 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 EAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGSGRDY-YEFYIQLNRCGTLGKNSLQE 284
            |..|..|.:::::.....|:|.:|..|.:....|:..:...... .||.|.:..|      :::.
 Worm    33 EVFCGIDTIRVKVNTEHPFNGRIYVDGESDKQHCVQHSADAHSSPQEFTIPIGAC------NMRR 91

  Fly   285 ESRKNPTNFMWN-TVTVQYNPLIEEEYDEHFKVTCEYGYDFWKTVTFPFLDVEVATGNPVVFTLS 348
            :...:|....:: |:...::|......|..|.:.|.:      ..:...|:.|:..|     ||:
 Worm    92 QRTLHPRGISFSFTMITSFHPFFVTGMDRAFSIRCFF------LESIKGLNAEIDVG-----TLA 145

  Fly   349 P---------PECYMEIQNGYGIGGPRVTGPV----RVGDPLTLIIYMRSKYDG---FDIVVNDC 397
            |         |.|...:::|       :.|.|    :||..:|.:  .|...|.   :.|:::.|
 Worm   146 PQHVDQEYSLPVCAYHLKDG-------IEGHVLRFAQVGQKVTHV--WRCDQDASHVYGILIHSC 201

  Fly   398 YAHNGANKRIQLIDQHGCPVDDKLISRFRGSWSDSGVYE---TQVYAYMKTFRFTGSPALYIECD 459
            ||.:|...:.:|:|..||..|..|:.:..        ||   ...|.....|::.....||..|.
 Worm   202 YADDGHGNKFELVDDRGCSTDPFLLPQIE--------YEHGAISAYTNAHVFKYADKVQLYFTCT 258

  Fly   460 VRMCH---GRCPSQPCHWRNLKAVTKRDTSNMTATNISIPPLSADGEGLT-TESPTANSLSENVN 520
            |::|:   |.|                       ..|:.|..|....|:. ::.|..:..   ||
 Worm   259 VQLCYKHDGGC-----------------------EGITPPQCSGHSHGIRGSKGPAEHKF---VN 297

  Fly   521 LFQSLRVLQEGETD---GDDVYAHRQTKPLSPHQTCLKTSTFSALTAG 565
            |        |.|||   |:|:.:..::.|..|..  :|..||..:..|
 Worm   298 L--------EPETDHHNGNDLGSSFESTPRVPGY--IKPDTFQPIILG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 55/273 (20%)
Zona_pellucida <371..472 CDD:278526 28/113 (25%)
cutl-7NP_001361852.1 ZP 36..278 CDD:214579 57/298 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.