DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and cutl-7

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_492410.2 Gene:cutl-7 WormBaseID:WBGene00009961 Length:585 Species:Caenorhabditis elegans

Alignment Length:373 Identity:76/374 (20%)
Similarity:137/374 (37%) Gaps:98/374 (26%)


  Fly   221 EAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGSGRDY-YEFYIQLNRCGTLGKNSLQE 284
            |..|..|.:::::.....|:|.:|..|.:....|:..:...... .||.|.:..|      :::.
 Worm    83 EVFCGIDTIRVKVNTEHPFNGRIYVDGESDKQHCVQHSADAHSSPQEFTIPIGAC------NMRR 141

  Fly   285 ESRKNPTNFMWN-TVTVQYNPLIEEEYDEHFKVTCEYGYDFWKTVTFPFLDVEVATGNPVVFTLS 348
            :...:|....:: |:...::|......|..|.:.|.:      ..:...|:.|:..|     ||:
 Worm   142 QRTLHPRGISFSFTMITSFHPFFVTGMDRAFSIRCFF------LESIKGLNAEIDVG-----TLA 195

  Fly   349 P---------PECYMEIQNGYGIGGPRVTGPV----RVGDPLTLIIYMRSKYDG---FDIVVNDC 397
            |         |.|...:::|       :.|.|    :||..:|.:  .|...|.   :.|:::.|
 Worm   196 PQHVDQEYSLPVCAYHLKDG-------IEGHVLRFAQVGQKVTHV--WRCDQDASHVYGILIHSC 251

  Fly   398 YAHNGANKRIQLIDQHGCPVDDKLISRFRGSWSDSGVYE---TQVYAYMKTFRFTGSPALYIECD 459
            ||.:|...:.:|:|..||..|..|:.:..        ||   ...|.....|::.....||..|.
 Worm   252 YADDGHGNKFELVDDRGCSTDPFLLPQIE--------YEHGAISAYTNAHVFKYADKVQLYFTCT 308

  Fly   460 VRMCH---GRCPSQPCHWRNLKAVTKRDTSNMTATNISIPPLSADGEGLT-TESPTANSLSENVN 520
            |::|:   |.|                       ..|:.|..|....|:. ::.|..:..   ||
 Worm   309 VQLCYKHDGGC-----------------------EGITPPQCSGHSHGIRGSKGPAEHKF---VN 347

  Fly   521 LFQSLRVLQEGETD---GDDVYAHRQTKPLSPHQTCLKTSTFSALTAG 565
            |        |.|||   |:|:.:..::.|..|..  :|..||..:..|
 Worm   348 L--------EPETDHHNGNDLGSSFESTPRVPGY--IKPDTFQPIILG 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 55/274 (20%)
Zona_pellucida <371..472 CDD:278526 28/114 (25%)
cutl-7NP_492410.2 ZP 86..328 CDD:214579 57/299 (19%)
Zona_pellucida <225..328 CDD:278526 29/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3774
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.