DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and cut-4

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_496242.2 Gene:cut-4 WormBaseID:WBGene00008482 Length:507 Species:Caenorhabditis elegans

Alignment Length:494 Identity:100/495 (20%)
Similarity:169/495 (34%) Gaps:163/495 (33%)


  Fly   221 EAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGSGRDYYEFYIQLNRCGTLGKNSLQEE 285
            |..|:...:.:......||:|.::..||..:|.||.: |.|:..:.|.::.:.||.         
 Worm    40 EVVCETASISLLFKTRNSFNGKVFVKGYVSEPSCMTV-GDGKTGHRFEVRHDSCGV--------- 94

  Fly   286 SRKNPTN--FMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWKTVTFPFLDVEVATGNPVVFTLS 348
            .|:...|  .:..||.:.::.:...:.|..::|:|.| .:..|.| ...:|:...|...:.....
 Worm    95 RRQREINGVVISATVIISFHSIFITKIDRAYRVSCFY-VEGTKKV-HNHVDISALTTQLLESETQ 157

  Fly   349 PPECYMEIQNGYGIGGPRVTGPVRVGDPL----TLIIYMRSKYDGFDIVVNDCYAHNG-ANKRIQ 408
            .|.|..||.|..| |.|  ....|:||.:    |.:..:.:.|   .:.|:.|..::| ....:.
 Worm   158 LPVCRYEILNEAG-GSP--IKYARIGDQVYHKWTCVAELENVY---CMKVHSCTVYDGQGGPPVT 216

  Fly   409 LIDQHGCPVDDKLISRFRGSWSDSGVYETQVYA--YMKTFRFTGSPALYIECDVRM--------C 463
            :||.:||.||..::....        |.:.:.|  ....|:|.....||..|.:::        |
 Worm   217 VIDANGCSVDGVILQNLE--------YTSDLTAGKLAPVFKFADKAGLYFNCQIQLTIKDVNYGC 273

  Fly   464 HG---RCPSQ--------------------------PCHWRNLKAVTKR---DTSNMTATNISI- 495
            ..   :||:.                          |....|....:.|   .|:...|:..|. 
 Worm   274 SNTQPQCPTSQYVVEPAQKTTETAEPYPYDSHESGYPTRPANYPVASSRYPIPTTQAPASYPSSP 338

  Fly   496 --PPLSAD--------------------GEGLT----TESPTANSL------------------- 515
              ||..||                    .:|:.    ||.|...|.                   
 Worm   339 APPPPGADIDNGYPEPQPIYIAETPENAYDGIVGFNDTEQPFTTSAAYTEDGVYSRLIKRNVVES 403

  Fly   516 SENVN--------------------LFQSLRVLQEGETD--GDDVYAHRQTKPL-----SPHQTC 553
            :|.:|                    |...|..:::|||.  ||    |..|:.|     |..:||
 Worm   404 TEQINASNKKRPVTVGDIDLPERGILVFGLEEMEDGETTNAGD----HGATRALREARNSQEKTC 464

  Fly   554 LKTST--FSALTAGCSAVLCVL---TVTLFIACSRLKRR 587
            ..||.  |:.:      :||:|   ||.:||...:.:|:
 Worm   465 FSTSRMYFTLI------LLCLLFATTVVVFIVIVQKQRQ 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 59/296 (20%)
Zona_pellucida <371..472 CDD:278526 25/145 (17%)
cut-4NP_496242.2 ZP 43..283 CDD:214579 58/266 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3774
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97979
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.