DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and cutl-29

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_509395.2 Gene:cutl-29 WormBaseID:WBGene00017421 Length:390 Species:Caenorhabditis elegans

Alignment Length:424 Identity:101/425 (24%)
Similarity:155/425 (36%) Gaps:121/425 (28%)


  Fly   224 CQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGSGRDYYEFYIQL---NRCGTLGKNSLQEE 285
            |....:::.:.|..||||.:.:........|.: .|:|.:.....|.|   .:|..:.       
 Worm    27 CTSSNIEVALTFAKSFSGGVLTENPRKYEQCRW-KGNGSNSMSINIPLFNSTKCAVVA------- 83

  Fly   286 SRKNPTNFMWNTVTVQYNP---LIEEEYDEHFKVTCEYG-YDFWKTVTFPFL------------- 333
               |.|:..: ::.:..:|   ||.:.:.. ..|.|.|. .|.  |:|.|.:             
 Worm    84 ---NETSGTY-SIKLLVSPVDGLIVDGFSA-INVKCIYATQDI--TLTLPPIFNGTNALQITAMN 141

  Fly   334 -DVEVATGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYDGFDIVVNDC 397
             |..|.||:.     ..|...|:|..|:||.|..|. ...||..:||.|.:::... :|..|:.|
 Worm   142 DDNSVVTGSG-----GSPALTMQILEGHGISGSPVV-KAAVGQRITLDIALQNTAI-YDFYVHSC 199

  Fly   398 YAHNGANK---RIQLIDQHGCPVDDKLISR------FRGSWSDSGVYETQVYAYMKTFRFTGSPA 453
            |||:|:|.   .|.:||.:||.|   .:||      .....:.:|  ...||.:|..|:||.:..
 Worm   200 YAHDGSNSPDASINIIDSNGCGV---RLSRAIDVPAMSAQPTPNG--PKHVYLHMYGFQFTSNNF 259

  Fly   454 LYIECDVRMCHGRC-------------PSQPCHWRNLKAVTKRDTSNM-TATNISIPPLSADGEG 504
            ::.||.|:.|...|             |..|.|.|........|.:.: ..|.:.|.|.|     
 Worm   260 VHFECQVKPCIKSCHREQCIREPDTKIPVIPAHRRRRHEDNSTDVATLRLETVLEISPQS----- 319

  Fly   505 LTTESPTANSLSENVNLFQSLRVLQEGETDGDDVY---AHRQTKPLSPHQTCLKTSTFSALTAGC 566
              |.|..|...||:                    |   ||..::|              ||.|.|
 Worm   320 --TLSAAALVSSED--------------------YARPAHCYSQP--------------ALIATC 348

  Fly   567 SAVLCVLTVTLFIACSRLKRR-----KESSLYDS 595
            :.|. |:|..|......:.||     |.||:.|:
 Worm   349 TFVF-VITALLVSMVHVVYRRWTKSDKTSSINDN 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 71/292 (24%)
Zona_pellucida <371..472 CDD:278526 35/123 (28%)
cutl-29NP_509395.2 ZP 26..278 CDD:214579 69/278 (25%)
Zona_pellucida <166..275 CDD:278526 36/116 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46560
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.