DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and cutl-18

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_505875.2 Gene:cutl-18 WormBaseID:WBGene00009830 Length:801 Species:Caenorhabditis elegans

Alignment Length:545 Identity:107/546 (20%)
Similarity:173/546 (32%) Gaps:171/546 (31%)


  Fly    66 GRIQTTTPSTRSTSGTRPLATGAEAQKELVGISSKSYISGPTT---QPSKLSK----RAGLAGPK 123
            |.::|...:|..:..|..:.|..:..|             |||   ..||:.|    :....|.|
 Worm   392 GAVETDNENTNCSVFTLNVITFEQELK-------------PTTIAPGDSKVKKPHKAKTFSTGNK 443

  Fly   124 KFPKDVRNRSSNALERNKLQHEVPDHVPDSSGYIPHRIGHPVHLDYGPTGVDSSGAPTGSGGYHA 188
            |..|.|..|.....:.:||            |..|..:.......:|...|..|  |.....::.
 Worm   444 KDQKKVEERKLYVKKSSKL------------GSSPLDVKISTQCTFGFISVKVS--PGNPDNHNL 494

  Fly   189 VPYENSKWQEEYWDQEYAGHQHQHNGTRVQHIEAECQ-----DDYMKIRIGFNGSFSGLLYSAGY 248
            |                .|..:..||      .:.|.     |....::|..|            
 Worm   495 V----------------GGEIYVRNG------HSNCSKTIGTDGEAILKIRHN------------ 525

  Fly   249 AYDPDCMYINGSGRDYYEFYIQLNRCGTLGKNSLQEESRKNPTNFMWNTVTVQYNPLIEEEYDEH 313
              |..|:..||   |.||..:.:.:         ..||..|.|     .:|:.         |:.
 Worm   526 --DTTCITKNG---DIYETVVVVTQ---------NVESVGNAT-----VITID---------DQL 562

  Fly   314 FKVTCEYGYD----------FWKTVTFPFLDVEVATGNPVVFTLSPPECYMEIQNGYGIGGPRVT 368
            |||.|:|...          ..:|..|..||:   .|...|..:|     ||::....|...|. 
 Worm   563 FKVRCDYSNQKNAVAVAKTMNLRTTQFNKLDI---YGKVNVKPMS-----MELRGKREIIKART- 618

  Fly   369 GPVRVGDPLTLIIYMRSKYDGFDIVVNDC--YAHNGANKRIQLIDQHGCPVDDKLISRFRGSWSD 431
              |::|..|.|:..:.:......:.|..|  |..||..|.|.:  ::||..........|....:
 Worm   619 --VKLGQSLDLVFTVDNSTSARHVFVKKCTAYDQNGDEKIILI--KNGCATQHAKEYVLRDEIKE 679

  Fly   432 SGVYETQVYAYMKTFRFTGSPALYIECDVRMCHGRCPSQPCHWRNLKAVTKRDTSNMTATNISIP 496
            :.   |......:.|||....|:.|||:|:.|. :|....|..||.:..|..::.:.|.      
 Worm   680 TA---TGFVLPFRAFRFKQGEAVKIECEVKYCE-KCKKANCPSRNRRFTTFDESEDTTL------ 734

  Fly   497 PLSADGEGLTTESPTANSLSENVN---LFQSLRVLQEGETDGDDVYAHRQTKPLSPHQTCLKTST 558
                          |.|..:|.|:   |.|:  ::...:.||                .||:.:.
 Worm   735 --------------TGNEDTEKVHAELLVQT--IVDSTQLDG----------------YCLQLNR 767

  Fly   559 FSALTAGCSAVLCVLTVTLFIACSR 583
            :.||.:....::.:..:.:...|.|
 Worm   768 WIALISLTVIIISIQFLLVIYICLR 792

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 59/267 (22%)
Zona_pellucida <371..472 CDD:278526 25/103 (24%)
cutl-18NP_505875.2 PAN_AP_HGF 105..177 CDD:238532
PAN_AP 187..258 CDD:214680
ZP 474..719 CDD:214579 67/326 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.