DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and cutl-24

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001023450.1 Gene:cutl-24 WormBaseID:WBGene00021396 Length:601 Species:Caenorhabditis elegans

Alignment Length:642 Identity:112/643 (17%)
Similarity:176/643 (27%) Gaps:329/643 (51%)


  Fly   197 QEEYWDQEYAGHQHQHNGTRVQHIEAECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDCMYINGSG 261
            |.:|...:||         .::.:.|.|..|.:...|.|:..|:|.:||..||...||:|.|...
 Worm    16 QNQYVTPQYA---------EIRAVSAMCSSDGITASIDFDKPFTGKIYSLNYANSNDCLYYNNID 71

  Fly   262 RDYYEFYIQLNRCGTLGKNSLQEESRK-NPTNFMWNTVTVQYNPLIEEEYDEHFKVTCE------ 319
            ||...|.|....|||    .||..:|. :..:.|.|.|.||.:...:...|:.|...|.      
 Worm    72 RDTVLFSIPSQLCGT----KLQRTTRNVSMIDQMENRVYVQMDKDTQTSADKQFSFVCRLTDPMK 132

  Fly   320 --------YG------------------------------------------------------- 321
                    :|                                                       
 Worm   133 MAAAKDDGFGTKDSYQQAPIKPVASSVSTKMHSSLMPIKPSEVRQVSAFSRDSHLGNWPIPGAKP 197

  Fly   322 YD--------------FWKTV---------------------------TFPFLDV---------- 335
            |:              |.:|:                           .||.:.|          
 Worm   198 YEPSMKPVSTYPMAPIFAETIPTSPAKDPSEGYVTRPISTVGHPSPPPLFPNIPVPQRSPPVVAR 262

  Fly   336 --EVATGNPVVFTL--------------------------------------------------- 347
              ..:|..||:||.                                                   
 Worm   263 VFTTSTMAPVMFTFPTTTTPLMPLFPIIPNVHFKQGVGVPFAPGTLPTTKVDASKWNDPSAYATA 327

  Fly   348 ---------------------------------------SP------------------------ 349
                                                   ||                        
 Worm   328 PSTVDSTTPKTYREQPPTADAPFSSDNSKEIHETSTIVASPGVPRPQADQPKDITSVLKTTQEQQ 392

  Fly   350 --PECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRS---KYDGFDIVVNDCYAHNG-ANKRIQ 408
              ||..:|||.|.|...|.||.|:::||.::|::..:|   :.|.||:.|:.|:|.:| .:.::|
 Worm   393 IEPEVTLEIQRGEGPFAPPVTTPIKIGDNISLVVKAKSYLNETDQFDMFVHSCFATDGKGDTKVQ 457

  Fly   409 LIDQHGCPVDDKLISRF-RGSWSDSGVYETQVYAYMKTFRFTGSPALYIECDVRMCHGRCPSQPC 472
            :||::||.:..:..|.. |...|::.::   .|..:|.|:|.|...:|..|              
 Worm   458 MIDENGCVIRLEFASPLHRAKDSENTMF---YYLLIKAFKFPGPDDVYFSC-------------- 505

  Fly   473 HWRNLKAVTKRDTSNMTATNISIPPLSADGEGLTTESPTANSLSENVNLFQSLR----VLQEGET 533
                               .|...|        .|::|         |:...||    :|:||.|
 Worm   506 -------------------TIEFTP--------KTKAP---------NICSKLRRRREILEEGMT 534

  Fly   534 D---GDDVYAHRQTKPLSPHQTCLKTSTFSALTAGCS-------AVLCVLTVTLFIA 580
            :   .|.|...     |....:.:||...|.....||       .|:.||.|::.|:
 Worm   535 EMRLFDSVNVE-----LENRDSNVKTEQLSTSPETCSEEKHLYIVVITVLLVSVTIS 586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 83/494 (17%)
Zona_pellucida <371..472 CDD:278526 26/106 (25%)
cutl-24NP_001023450.1 Zona_pellucida <416..521 CDD:278526 31/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139553580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008062
OrthoInspector 1 1.000 T375307
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46560
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.