| Sequence 1: | NP_647901.1 | Gene: | CG15020 / 38544 | FlyBaseID: | FBgn0035543 | Length: | 604 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_490798.1 | Gene: | cutl-20 / 171678 | WormBaseID: | WBGene00018787 | Length: | 360 | Species: | Caenorhabditis elegans |
| Alignment Length: | 356 | Identity: | 81/356 - (22%) |
|---|---|---|---|
| Similarity: | 142/356 - (39%) | Gaps: | 71/356 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 224 CQDDYMKIRIGFNGSFSGLLYS-AGYAYDPDCMYINGS--GRDYYEFYIQLNRCGTL--GKNSLQ 283
Fly 284 EESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWK--TVTFPFLDVEVATGNPVVFT 346
Fly 347 LSPPECY---MEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYDGFDIVVNDCYAHNGANKRIQ 408
Fly 409 LIDQHGCPVDDKLISRFRGS-WSDSGVY----ETQVYAYMKTFRFTGSPALYIECDVRMCHGRCP 468
Fly 469 SQPCHWRNLK---------AVTKRDTSNMTATNISIPPL------------------SADGEGLT 506
Fly 507 TESPT---ANSLSENVNLFQSLRVLQEGETD 534 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15020 | NP_647901.1 | ZP | 223..473 | CDD:214579 | 63/263 (24%) |
| Zona_pellucida | <371..472 | CDD:278526 | 27/105 (26%) | ||
| cutl-20 | NP_490798.1 | Zona_pellucida | 30..268 | CDD:365872 | 63/262 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | otm14780 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR46560 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.010 | |||||