DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15020 and cutl-13

Sequence 1:NP_647901.1 Gene:CG15020 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_490736.2 Gene:cutl-13 WormBaseID:WBGene00021025 Length:445 Species:Caenorhabditis elegans

Alignment Length:448 Identity:84/449 (19%)
Similarity:154/449 (34%) Gaps:123/449 (27%)


  Fly   223 ECQDDYMKIRIGFNGSFSGLLYSAGYAYDPDC----MYINGSGRDYYEFYIQLNRCGTLGKNSLQ 283
            :|..:.:.........|.|.:|..|:...|.|    :..|.:|.   .|.::|..||......:.
 Worm    30 QCNPESITFSFNTRNPFIGNVYIRGFYRTPGCRRQFLAPNQAGG---SFTVRLGDCGMRRSRQIS 91

  Fly   284 EESRKNPTNFMWNTVTVQYNPLIEEEYDEHFKVTCEYGYDFWKTVTFPFLDV------EVATGNP 342
            ..|.:.....:  |....::|.:..:.:..|.:.|.|.:.  ::|....|||      ....|..
 Worm    92 GHSPRGVNQHI--TFVANFHPNLATKEERSFNIRCFYAHS--ESVVKADLDVSSMPEESFEQGVT 152

  Fly   343 VVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLIIYMRSKYD-----GFDIVVNDCYAHNG 402
            :|     |:|...::.| ...||:|:. .|||  :|::    .::|     .:.|::..|...:.
 Worm   153 IV-----PQCTYSLREG-TFEGPKVSN-TRVG--MTIV----HRWDCDTSGNYGILLRGCTILDS 204

  Fly   403 AN-KRIQLIDQHGCPVDDKLISRFRGSWSDSGVY---ETQVYAYMKTFRFTGSPALYIECDVRMC 463
            .. :...|:|::||.|....         ...||   .|..|..::...|...|::...|.:::|
 Worm   205 RGVESFPLLDENGCSVSRDF---------PQVVYLPSLTSAYMAIEAISFPDQPSISFSCQIKLC 260

  Fly   464 ---HGRC-----------------------------------PSQPCHWRNLKAVTKRDTSNMTA 490
               ...|                                   |.:|  |....:....|.:|:|:
 Worm   261 DKGSDECRGMSPPACTPLTQVPITGQVPMPFDNTIGNTFDGIPLEP--WMKEPSPPTDDVANITS 323

  Fly   491 TNISIPPLSADGEGLTTESPTANSLSENV--NLFQSLRVLQEGETDGDDVYAHRQTKPL------ 547
            ....:|.|..:.|....||....:..:..  .||         ....:|:|.....:|:      
 Worm   324 EGEPMPRLITEEEQYQIESNHVEAREKRFAHRLF---------NITSEDLYVEPTVEPMEVEMPG 379

  Fly   548 SPHQT-------CLKTSTF--SALTAGCSAVLCVLTVTLFIAC----SRLKRRKESSL 592
            :|.:|       |:...||  |||     |||.|..|::.:.|    ..||:.::..:
 Worm   380 APRETARRVSEPCVSVETFYISAL-----AVLFVFVVSIGMVCFFGSHMLKKTQDCEM 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15020NP_647901.1 ZP 223..473 CDD:214579 54/307 (18%)
Zona_pellucida <371..472 CDD:278526 23/148 (16%)
cutl-13NP_490736.2 ZP 30..278 CDD:214579 52/277 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97979
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.