DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DOR and Tp53inp2

Sequence 1:NP_001246624.1 Gene:DOR FlyBaseID:FBgn0035542 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001257876.1 Gene:Tp53inp2 RGDID:735085 Length:221 Species:Rattus norvegicus

Alignment Length:216 Identity:67/217 (31%)
Similarity:102/217 (47%) Gaps:41/217 (19%)


  Fly   203 LSISTLSPPR--SVPALGAGDHDTL-------TQSLYVASPSGSDQGQDHGQ--GANVLMEESWY 256
            |..||.:||.  :.|.....:.|.:       .|..|.|.|.........|:  .|..||:|||:
  Rat     8 LFFSTPAPPEDSNCPGAFVSEEDEVDGWLIIDLQDSYTAPPDPRASPAPAGRPPPAPSLMDESWF 72

  Fly   257 VTPPPCFTS----IGPINMETSPFENLLIEHPSMSVYHSIRSTQEGTDSFVNLDLGVSTEVPQQR 317
            ||||.|||:    :||..::::|.|:|||||||||||        .|.|.:.|:.|..:      
  Rat    73 VTPPACFTAEGPGLGPARLQSNPLEDLLIEHPSMSVY--------VTGSTIVLESGPPS------ 123

  Fly   318 EEPEPEAEPQDQRQA---LQEQQRAPNARFDSHA-----AVQLKQQTLARQSQKSKNKKEHQQLC 374
              |.|||...||..:   |...:|.|.|...:.|     ||.|::....|:.|:::.:.|...|.
  Rat   124 --PHPEAALPDQDLSDGELAPARREPRALHHAAAPMPARAVLLEKAGQVRRLQRARQRAERHTLS 186

  Fly   375 RSAIKRANKVRDFQAKANRPR 395
            ...::|.|:.|  ::::.||:
  Rat   187 AKVLQRQNRAR--ESRSRRPK 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DORNP_001246624.1 DOR 111..406 CDD:291505 67/217 (31%)
Tp53inp2NP_001257876.1 LIR 26..41 1/15 (7%)
DOR <67..212 CDD:291505 53/158 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002689
OrthoInspector 1 1.000 T617532
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR31671
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.