DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS6 and AT3G18760

DIOPT Version :8

Sequence 1:NP_001246623.1 Gene:mRpS6 / 38535 FlyBaseID:FBgn0035534 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_566618.1 Gene:AT3G18760 / 821407 AraportID:AT3G18760 Length:139 Species:Arabidopsis thaliana

Alignment Length:86 Identity:20/87 (23%)
Similarity:41/87 (47%) Gaps:5/87 (6%)


  Fly     1 MPSYELALVLRQLPRPE-LISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHGVVHREGTHF 64
            ||.|:..|:.:.:.|.| ||.::.|..:.:..:.|::.::::.|...|.:.:.:....|.:|...
plant     1 MPLYDCMLLFKPIIRKEGLIDLVARIGKHVYSRNGVLTEIKSFGKVELGYGIRKLDGRHYQGQLM 65

  Fly    65 TIAFDTAPTKIADL----KEE 81
            .|...|.|....:|    ||:
plant    66 QITMMTTPNMNKELHYLNKED 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS6NP_001246623.1 bS6_mito 3..96 CDD:275386 18/85 (21%)
AT3G18760NP_566618.1 bS6_mito 3..96 CDD:275386 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1473530at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21011
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.