DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS6 and mrps6

DIOPT Version :8

Sequence 1:NP_001246623.1 Gene:mRpS6 / 38535 FlyBaseID:FBgn0035534 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001038921.1 Gene:mrps6 / 751746 ZFINID:ZDB-GENE-060825-59 Length:118 Species:Danio rerio

Alignment Length:111 Identity:43/112 (38%)
Similarity:69/112 (62%) Gaps:2/112 (2%)


  Fly     1 MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHGVVHREGTHFT 65
            ||.|||.:||:.:.|||..:|:|||.|::.::|.::|.|||||.|.||:|:|:|......|.:|:
Zfish     1 MPRYELYMVLKAMQRPETAAVLRRTVETLFERGAVVRSLENLGERKLPYKISKHDSRQSHGGYFS 65

  Fly    66 IAFDTAPTKIADLKEEFGRDIDIIRRYIFK--VEEPEQKPCTLHEE 109
            |.|..:|..::.|.....||:|::|..:.|  .|.|:.:.|.:..|
Zfish    66 IDFHASPNIVSGLLNHLERDVDVLRPTVVKKDTELPKGQCCGVARE 111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS6NP_001246623.1 bS6_mito 3..96 CDD:275386 37/95 (39%)
mrps6NP_001038921.1 bS6_mito 3..96 CDD:275386 37/93 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1473530at2759
OrthoFinder 1 1.000 FOG0004169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131334
Panther 1 1.100 LDO PTHR21011
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.