DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS6 and Mrps6

DIOPT Version :8

Sequence 1:NP_001246623.1 Gene:mRpS6 / 38535 FlyBaseID:FBgn0035534 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_536704.1 Gene:Mrps6 / 121022 MGIID:2153111 Length:125 Species:Mus musculus

Alignment Length:126 Identity:49/127 (39%)
Similarity:74/127 (58%) Gaps:11/127 (9%)


  Fly     1 MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHGVVHREGTHFT 65
            ||.|||||:|:.:.|||..:.::||.||::|:|.|:|.||:||.||||:::|.|...|..|.:|.
Mouse     1 MPRYELALILKAMRRPETAAALKRTIESLMDRGAIVRNLESLGERALPYRISSHSQQHSRGGYFL 65

  Fly    66 IAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEEP---EQKPC------TLHEEMLPPAYRK 117
            :.|....:.:.::.|...||||::|..|  |:.|   |.|.|      .|.|::.....||
Mouse    66 VDFYAPTSAVENILEHLARDIDVVRPNI--VKHPLTQEVKECDGIVPVPLEEKLYSTKRRK 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS6NP_001246623.1 bS6_mito 3..96 CDD:275386 38/93 (41%)
Mrps6NP_536704.1 bS6_mito 3..96 CDD:275386 39/95 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0360
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I5031
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004169
OrthoInspector 1 1.000 T1085302
orthoMCL 1 0.900 OOG5_131334
Panther 1 1.100 LDO PTHR21011
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3570
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.