DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS6 and mrps6

DIOPT Version :8

Sequence 1:NP_001246623.1 Gene:mRpS6 / 38535 FlyBaseID:FBgn0035534 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001090858.1 Gene:mrps6 / 100038272 XenbaseID:XB-GENE-5902338 Length:122 Species:Xenopus tropicalis

Alignment Length:105 Identity:46/106 (43%)
Similarity:69/106 (65%) Gaps:1/106 (1%)


  Fly     1 MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHGVVHREGTHFT 65
            ||.||:||:|:.:.|||..:.::||.|::.:.|.::|.|||||.:|||:|:|:|.:.|..|.:|.
 Frog     1 MPRYEMALILKAMQRPETAATLKRTIEALFEGGAVVRNLENLGEKALPYKISKHNLRHTRGGYFL 65

  Fly    66 IAFDTAPTKIADLKEEFGRDIDIIRRYIFKVE-EPEQKPC 104
            |.|...||.|..:.:...||||:||..|.|.| :.|:|.|
 Frog    66 IDFHAPPTIIPSMLDHLSRDIDVIRPTILKQEQQKEEKEC 105

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpS6NP_001246623.1 bS6_mito 3..96 CDD:275386 40/93 (43%)
mrps6NP_001090858.1 bS6_mito 3..94 CDD:275386 39/91 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1473530at2759
OrthoFinder 1 1.000 FOG0004169
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.