DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fdx2 and MFDX2

Sequence 1:NP_647889.2 Gene:Fdx2 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001031685.1 Gene:MFDX2 AraportID:AT4G21090 Length:197 Species:Arabidopsis thaliana

Alignment Length:104 Identity:45/105 (43%)
Similarity:71/105 (68%) Gaps:2/105 (2%)


  Fly    41 VNITFVRANGDKIKTSGKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKP 105
            :|:|||..:|::|.....||.::|:....|:::|:  |||||:|.|||||:|...:.:....::|
plant    81 INVTFVDKDGEEIHIKVPVGMNILEAAHENDIELE--GACEGSLACSTCHVIVMDTKYYNKLEEP 143

  Fly   106 GDEELDMLDLAYELTDTSRLGCQITLSKDMEGLEVHVPS 144
            .|||.||||||:.||.|||||||:....:::|:.:.:||
plant   144 TDEENDMLDLAFGLTATSRLGCQVIAKPELDGVRLAIPS 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:294106 44/103 (43%)
MFDX2NP_001031685.1 PLN02593 81..197 CDD:178203 45/105 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1380051at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.703 Consistency score
21.920

Return to query results.
Submit another query.