DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx2 and AT3G07480

DIOPT Version :9

Sequence 1:NP_647889.2 Gene:Fdx2 / 38530 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_566309.1 Gene:AT3G07480 / 819936 AraportID:AT3G07480 Length:159 Species:Arabidopsis thaliana


Alignment Length:138 Identity:42/138 - (30%)
Similarity:65/138 - (47%) Gaps:16/138 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RSLNLRSPIATRTFSTGLALK--TKDVVNITFVRANGDKIKTSGKVGDSLLDVVVNNN-VD---- 73
            |||.:|:. ||...|..|..|  :..:|.::.:..:|.|....|..|.:||..:.:.. :|    
plant    20 RSLIVRTS-ATSAPSPSLGSKKVSDRIVKLSAIDPDGYKQDIIGLSGQTLLRALTHTGLIDPASH 83

  Fly    74 -LDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEE--LDMLDLAYELTDTSRLGCQITLSKDM 135
             ||...||.     :.|.:.......||||.:..|||  |.....:..|...||||||:.|::::
plant    84 RLDDIEACS-----AECEVQIAEEWLEKLPPRTYDEEYVLKRSSRSRILNKHSRLGCQVVLTQEL 143

  Fly   136 EGLEVHVP 143
            :|:.|.||
plant   144 QGMVVAVP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:412190 33/111 (30%)
AT3G07480NP_566309.1 fer2 46..153 CDD:412190 33/111 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23426
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.