DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fdx2 and AT3G07480

Sequence 1:NP_647889.2 Gene:Fdx2 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_566309.1 Gene:AT3G07480 AraportID:AT3G07480 Length:159 Species:Arabidopsis thaliana

Alignment Length:138 Identity:42/139 (30%)
Similarity:65/139 (47%) Gaps:16/139 (12%)


  Fly    16 RSLNLRSPIATRTFSTGLALK--TKDVVNITFVRANGDKIKTSGKVGDSLLDVVVNNN-VD---- 73
            |||.:|:. ||...|..|..|  :..:|.::.:..:|.|....|..|.:||..:.:.. :|    
plant    20 RSLIVRTS-ATSAPSPSLGSKKVSDRIVKLSAIDPDGYKQDIIGLSGQTLLRALTHTGLIDPASH 83

  Fly    74 -LDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEE--LDMLDLAYELTDTSRLGCQITLSKDM 135
             ||...||.     :.|.:.......||||.:..|||  |.....:..|...||||||:.|::::
plant    84 RLDDIEACS-----AECEVQIAEEWLEKLPPRTYDEEYVLKRSSRSRILNKHSRLGCQVVLTQEL 143

  Fly   136 EGLEVHVP 143
            :|:.|.||
plant   144 QGMVVAVP 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:294106 33/112 (29%)
AT3G07480NP_566309.1 fer2 46..153 CDD:320788 33/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1380051at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.