DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fdx2 and Fdx1

Sequence 1:NP_647889.2 Gene:Fdx2 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_058822.1 Gene:Fdx1 RGDID:62036 Length:188 Species:Rattus norvegicus

Alignment Length:114 Identity:66/115 (57%)
Similarity:84/115 (73%) Gaps:1/115 (1%)


  Fly    37 TKDVVNITFVRANGDKIKTSGKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKL 101
            ::|.|.:.|...:|:.:.|.|||||||||||:.||:|:||||||||||.||||||||:...:|||
  Rat    67 SEDKVTVHFKNRDGETLTTKGKVGDSLLDVVIENNLDIDGFGACEGTLACSTCHLIFEDHIYEKL 131

  Fly   102 PDKPGDEELDMLDLAYELTDTSRLGCQITLSKDMEGLEVHVPSTINDAR 150
             |...|||.||||||:.||:.||||||:.|:|.|:.:.|.||..:.|.|
  Rat   132 -DAITDEENDMLDLAFGLTNRSRLGCQVCLTKAMDNMTVRVPEAVADVR 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:294106 63/103 (61%)
Fdx1NP_058822.1 fer2 71..174 CDD:294106 63/104 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0633
Hieranoid 1 1.000
Homologene 1 1.000 H31216
Inparanoid 1 1.050 136 1.000 Inparanoid score I4404
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1380051at2759
OrthoFinder 1 1.000 FOG0004926
OrthoInspector 1 1.000 T1087020
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23426
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
109.930

Return to query results.
Submit another query.