DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fdx2 and Y73F8A.27

Sequence 1:NP_647889.2 Gene:Fdx2 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_502861.1 Gene:Y73F8A.27 WormBaseID:WBGene00013532 Length:169 Species:Caenorhabditis elegans

Alignment Length:152 Identity:59/153 (39%)
Similarity:87/153 (57%) Gaps:22/153 (14%)


  Fly    12 RLALRSLNLRS--------PIATRTFSTGLALKTKD-----------VVNITFVRANGDKIKTSG 57
            |||:|:.....        |:..|.|.|....||.|           |||||:|..:|.:.|..|
 Worm     6 RLAMRAKGFSRFLAETQAFPVKNRHFMTSSVRKTGDFEYEDPKSEDEVVNITYVLRDGTERKIRG 70

  Fly    58 KVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELTDT 122
            ||||:::.:....:::::  ||||.:|.|||||:....:...|||: |.:||.||||:|..|.|.
 Worm    71 KVGDNVMFLAHRYDIEME--GACEASLACSTCHVYVDPAFQNKLPE-PLEEEDDMLDMAPALKDN 132

  Fly   123 SRLGCQITLSKDMEGLEVHVPS 144
            |||||||.|:|:::|:.|.:|:
 Worm   133 SRLGCQIVLTKELDGITVTLPT 154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:294106 47/103 (46%)
Y73F8A.27NP_502861.1 PLN02593 54..169 CDD:178203 47/105 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R421
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.