DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fdx2 and cox-15

Sequence 1:NP_647889.2 Gene:Fdx2 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_496402.1 Gene:cox-15 WormBaseID:WBGene00011526 Length:395 Species:Caenorhabditis elegans

Alignment Length:135 Identity:25/136 (18%)
Similarity:46/136 (34%) Gaps:52/136 (38%)


  Fly    12 RLALRSLNLRSPIATRTFSTGLALKTKDVVNITFVRANGDKIKTSGKVGDSLLDVVVNNNVDLDG 76
            |::|.|..:::  ..:.|.....:..|||.:           |:..::|..|:...         
 Worm    17 RVSLLSQGIQN--VRQGFRRNFGISVKDVDD-----------KSRKRIGWWLMGCA--------- 59

  Fly    77 FGACEGT--------LTCSTCHLI----FKT-----------SDFEK---LPD---KPGDEELDM 112
             |.|.|.        ||.|...::    |:|           .:|||   .|:   |...||:.:
 Worm    60 -GMCYGAVALGGVTRLTESGLSMVNWDLFRTMKPPFGQKQWEEEFEKYKAYPEYKYKSSSEEMTL 123

  Fly   113 LDLAY 117
            .:..:
 Worm   124 NEFKF 128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:294106 18/107 (17%)
cox-15NP_496402.1 COX15-CtaA 52..384 CDD:280746 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R421
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.