DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fdx2 and Fdx1

Sequence 1:NP_647889.2 Gene:Fdx2 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_032022.1 Gene:Fdx1 MGIID:103224 Length:188 Species:Mus musculus

Alignment Length:114 Identity:65/115 (57%)
Similarity:84/115 (73%) Gaps:1/115 (1%)


  Fly    37 TKDVVNITFVRANGDKIKTSGKVGDSLLDVVVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKL 101
            ::|.:.:.|...:|:.:.|.||:||||||||:.||:|:||||||||||.||||||||:...:|||
Mouse    67 SEDKITVHFKNRDGETLTTKGKIGDSLLDVVIENNLDIDGFGACEGTLACSTCHLIFEDHIYEKL 131

  Fly   102 PDKPGDEELDMLDLAYELTDTSRLGCQITLSKDMEGLEVHVPSTINDAR 150
             |...|||.||||||:.|||.||||||:.|:|.|:.:.|.||..:.|.|
Mouse   132 -DAITDEENDMLDLAFGLTDRSRLGCQVCLTKAMDNMTVRVPEAVADVR 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:294106 62/103 (60%)
Fdx1NP_032022.1 fer2 71..174 CDD:294106 62/104 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0633
Hieranoid 1 1.000
Homologene 1 1.000 H31216
Inparanoid 1 1.050 138 1.000 Inparanoid score I4487
Isobase 1 0.950 0 Normalized mean entropy S1416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1380051at2759
OrthoFinder 1 1.000 FOG0004926
OrthoInspector 1 1.000 T1083461
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23426
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R421
TreeFam 1 0.960
1211.910

Return to query results.
Submit another query.