DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fdx2 and LOC100498263

Sequence 1:NP_647889.2 Gene:Fdx2 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_002936827.1 Gene:LOC100498263 XenbaseID:XB-GENE-5934218 Length:178 Species:Xenopus tropicalis

Alignment Length:148 Identity:68/149 (46%)
Similarity:96/149 (64%) Gaps:8/149 (5%)


  Fly     7 CRAA----SRLALRSLNLRSPIATRTFSTGLALKTKDVVNITFVRANGDKIKTSGKVGDSLLDVV 67
            |||.    |..|.|.:..........||:|   .:.|.:.:.|:..||:.:..:.|.|:|||:||
 Frog    24 CRAVTHTNSICAARGITTTPQRQDALFSSG---DSDDKITVNFINRNGETLTATAKEGESLLEVV 85

  Fly    68 VNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELTDTSRLGCQITLS 132
            :.:::::||||||||||.||||||||....:||| ....|||:||||||:.||:|||||||:.::
 Frog    86 IRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKL-SAVSDEEMDMLDLAFGLTETSRLGCQVCMT 149

  Fly   133 KDMEGLEVHVPSTINDAR 150
            |.::||.|.||..::|||
 Frog   150 KALDGLTVRVPVDVSDAR 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:294106 55/103 (53%)
LOC100498263XP_002936827.1 fer2 59..160 CDD:294106 54/102 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4216
OMA 1 1.010
OrthoDB 1 1.010 D1380051at2759
OrthoFinder 1 1.000 FOG0004926
OrthoInspector 1 1.000 T601296
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.