DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fdx2 and fdx1

Sequence 1:NP_647889.2 Gene:Fdx2 FlyBaseID:FBgn0035529 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_001922722.2 Gene:fdx1 ZFINID:ZDB-GENE-071015-2 Length:175 Species:Danio rerio

Alignment Length:150 Identity:72/150 (48%)
Similarity:101/150 (67%) Gaps:13/150 (9%)


  Fly     4 INSCRA--ASRLALRSLNLRSPIATRTFSTGLALKTKDVVNITFVRANGDKIKTSGKVGDSLLDV 66
            |:..||  .|...:|.:|        |::.  :|:.::.|.:.|:..:|.:|.....:|:|||||
Zfish    24 ISQTRAFPQSYTHIRGIN--------TYAN--SLRAEEKVTVHFLNRDGKRITVKASIGESLLDV 78

  Fly    67 VVNNNVDLDGFGACEGTLTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELTDTSRLGCQITL 131
            ||:.::|:||||||||||.||||||||:...::|| ....|||:|||||||.||||||||||:.|
Zfish    79 VVDRDLDIDGFGACEGTLACSTCHLIFEEDVYKKL-GPVSDEEMDMLDLAYGLTDTSRLGCQVCL 142

  Fly   132 SKDMEGLEVHVPSTINDARA 151
            .||::|:.:.||..|:||||
Zfish   143 RKDLDGMILRVPDVISDARA 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fdx2NP_647889.2 fer2 41..144 CDD:294106 59/103 (57%)
fdx1XP_001922722.2 PLN02593 53..155 CDD:178203 59/103 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131093329
eggNOG 1 0.900 E1_COG0633
Hieranoid 1 1.000
Homologene 1 1.000 H31216
Inparanoid 1 1.050 139 1.000 Inparanoid score I4417
OMA 1 1.010
OrthoDB 1 1.010 D1380051at2759
OrthoFinder 1 1.000 FOG0004926
OrthoInspector 1 1.000 T597045
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23426
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R421
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.