DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIEbeta and TFA2

Sequence 1:NP_523923.1 Gene:TfIIEbeta FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_012988.1 Gene:TFA2 SGDID:S000001770 Length:328 Species:Saccharomyces cerevisiae

Alignment Length:339 Identity:77/340 (23%)
Similarity:129/340 (38%) Gaps:81/340 (24%)


  Fly     2 DPALLREREAFKKRAMATPTV------EKKSKP----------DRPAPPPPSDDSRRKMRPP--- 47
            || ||....|||.:..:.|.:      :||:..          .|.|.....:::....:.|   
Yeast     6 DP-LLANLNAFKSKVKSAPVIAPAKVGQKKTNDTVITIDGNTRKRTASERAQENTLNSAKNPVLV 69

  Fly    48 -----------NAPRLDATTYKTMSGSS---QYRFGVLA---------KIVK-------FMRTRH 82
                       ||..||........|||   :.|.|.:|         .|.|       ...|.:
Yeast    70 DIKKEAGSNSSNAISLDDDDDDEDFGSSPSKKVRPGSIAAAALQANQTDISKSHDSSKLLWATEY 134

  Fly    83 QDGDDHPLTIDEILDETNQLDIGQSVKNWLASEALHNNPKVEASPCGTKFSFKPVYKIKDGKTLM 147
            ......|:.::|:||..:.      .|:....|.|....::|..|....|.:...|.:.....|:
Yeast   135 IQKKGKPVLVNELLDYLSM------KKDDKVIELLKKLDRIEFDPKKGTFKYLSTYDVHSPSELL 193

  Fly   148 RLLK-QHDLKGLGGILLDDVQESLPHCEKVLK--NRSAEILFVVRPIDK-KKILFYNDRTANFSV 208
            :||: |...|   ||...|:::..|.|::.:.  ...::||.:....|| .:.::||.......:
Yeast   194 KLLRSQVTFK---GISCKDLKDGWPQCDETINQLEEDSKILVLRTKKDKTPRYVWYNSGGNLKCI 255

  Fly   209 DDEFQKLWRSATVDAMDDAKIDEYLEKQGIRSMQDHGLKKA------IPKRKK--AANKKRQFKK 265
            |:||.|:|        ::.::.::.|..  |.:||.|||.|      |.::.|  ...||||.|.
Yeast   256 DEEFVKMW--------ENVQLPQFAELP--RKLQDLGLKPASVDPATIKRQTKRVEVKKKRQRKG 310

  Fly   266 PRDNEHLADVLEVY 279
            ...|.|:..:|:.|
Yeast   311 KITNTHMTGILKDY 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 20/99 (20%)
TFA2NP_012988.1 TFA2 1..328 CDD:227501 77/340 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191745861
eggNOG 1 0.900 E1_COG5174
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129561
Panther 1 1.100 LDO PTHR12716
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1465
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.