DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIEbeta and AT4G21010

Sequence 1:NP_523923.1 Gene:TfIIEbeta FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_193833.1 Gene:AT4G21010 AraportID:AT4G21010 Length:275 Species:Arabidopsis thaliana

Alignment Length:196 Identity:49/197 (25%)
Similarity:92/197 (47%) Gaps:24/197 (12%)


  Fly    94 EILDETNQLDIGQSVKNWLASEALHNNPKVEASPCGTKFSFKPVYKIKDGKTLMRLLKQHDLKGL 158
            |.::|...:|:.   .|....::|..||||...  |.:||:|..:.|||.|.|:..:.:.|..  
plant    91 EQINEACYVDMH---NNKAVFDSLRKNPKVHYD--GRRFSYKATHNIKDKKQLLSFVNKSDKV-- 148

  Fly   159 GGILLDDVQESLPHCEKVLKN--RSAEILFVVRPIDKKKILFYNDRTANFSVDDEFQKLWRSATV 221
              |.:.|::::.|:..:.||:  .|.||.:::...|.|:...|.:......:|||.:.|:|.  :
plant   149 --IDVSDLKDAYPNVMEDLKSLKSSGEIFWLLSNTDSKEGTVYRNNMEYPKIDDELKALFRD--I 209

  Fly   222 DAMDDAKIDEYLEKQGIR----------SMQDHGLKKAIPKRKKAANKKRQFKKPRDNEHLADVL 276
            ...|..::::.|.|.|::          :.|.||:... ||.||...|:...:....|.|:.::.
plant   210 IPSDMLEVEKELLKIGLKPATNIAERRAAEQLHGVSNK-PKDKKKKKKEITNRTKLTNSHMLELF 273

  Fly   277 E 277
            :
plant   274 Q 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 14/47 (30%)
AT4G21010NP_193833.1 TFIIE_beta_winged_helix <72..275 CDD:295194 49/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2511
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1160863at2759
OrthoInspector 1 1.000 T124899
orthoMCL 1 0.900 OOG5_129561
Panther 1 1.100 O PTHR12716
Phylome 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.