DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIEbeta and AT4G20330

Sequence 1:NP_523923.1 Gene:TfIIEbeta FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_193766.1 Gene:AT4G20330 AraportID:AT4G20330 Length:286 Species:Arabidopsis thaliana

Alignment Length:285 Identity:70/286 (24%)
Similarity:125/286 (44%) Gaps:49/286 (17%)


  Fly     7 REREAFKKRAMATPTVEKKSKPDRPAPPPPSDDSRRKMRPPNAPRLDATTYKTMSGSSQYRFGVL 71
            |||.:..::.:..|....:.||| .||...|.|:.|.....|       ..|...|:.      :
plant    28 RERTSSSRQNVPLPAAITQKKPD-AAPVKFSSDTERLQNINN-------IRKAPVGAQ------I 78

  Fly    72 AKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQSVKNWLASEALHNNPKVEASPCGTKFSFKP 136
            .:::..:..|..     .||.::| :|...:|:.   .|....::|..|||....  |.:||:|.
plant    79 KRVIDLLYERRL-----ALTPEQI-NEWCHVDMH---ANKAVFDSLRKNPKAHYD--GRRFSYKA 132

  Fly   137 VYKIKDGKTLMRLLKQHDLKGLGGILLDDVQESLPHCEKVLKNRSAEILFVVRPIDKKKILFYND 201
            .:.:.|...|:.|::::    |.||.:.|::::.|:..:.||..||.....:....::.|.:.||
plant   133 THDVNDKNQLLSLVRKY----LDGIAVVDLKDAYPNVMEDLKALSASGDIYLLSNSQEDIAYPND 193

  Fly   202 RTANFSVDDEFQKLWRSATV--DAMDDAKIDEYLEKQGIR----------SMQDHGLKKAIPKRK 254
            ......|||||:.|:|...:  |.:|   :::.|.|.|::          :.|.||:... ||.|
plant   194 FKCEIKVDDEFKALFRDINIPNDMLD---VEKELLKIGLKPATNTAERRAAAQTHGISNK-PKDK 254

  Fly   255 KAANKKRQFKK--PRDNEHLADVLE 277
            |  .||::..|  ...|.||.::.:
plant   255 K--KKKQEISKRTKLTNAHLPELFQ 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 16/80 (20%)
AT4G20330NP_193766.1 TFIIE_beta_winged_helix <57..272 CDD:295194 60/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2511
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1160863at2759
OrthoInspector 1 1.000 T124899
orthoMCL 1 0.900 OOG5_129561
Panther 1 1.100 LDO PTHR12716
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.