DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIEbeta and Gtf2e2

Sequence 1:NP_523923.1 Gene:TfIIEbeta FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_006509248.1 Gene:Gtf2e2 MGIID:1915403 Length:295 Species:Mus musculus

Alignment Length:297 Identity:163/298 (55%)
Similarity:210/298 (70%) Gaps:22/298 (7%)


  Fly     1 MDPALLREREAFKKRAMATPTVEKKSKPDRPAPPPPSDDSRRKM----------RPPNAPRLDAT 55
            |||:|||:||.|||||::||.|||::.   |:..|.|..|::|.          ...|:...:.:
Mouse     4 MDPSLLRDRELFKKRALSTPVVEKRAV---PSESPSSSSSKKKKAKVEHGGSSGSKQNSDHNNGS 65

  Fly    56 -TYKTMSGSSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQSVKNWLASEALHN 119
             ..|.:||||.|:||||||||.:|:||||.||.||||::||||||..||||...|.||.:|||.|
Mouse    66 FNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLEEILDETQHLDIGLKQKQWLMTEALVN 130

  Fly   120 NPKVEASPCGTKFSFKPVYKIKDGKTLMRLLKQHDLKGLGGILLDDVQESLPHCEKVLKNRSAEI 184
            |||:|.  ...|::|||.|.:||.|.|:|||..||.:|||||||:|::|.||:.:|.:|....:|
Mouse   131 NPKIEV--VDGKYAFKPKYNLKDKKALLRLLDNHDQRGLGGILLEDIEEGLPNSQKAVKALGDQI 193

  Fly   185 LFVVRPIDKKKILFYNDRTANFSVDDEFQKLWRSATVDAMDDAKIDEYLEKQGIRSMQDHGLKK- 248
            |||.|| |||||||:||::..||||:||||||||.|||:||:.||:|||::|||.|||:.|.|| 
Mouse   194 LFVSRP-DKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKV 257

  Fly   249 -AIPKRKK-AANKKRQFKKPRDNEHLADVLEVYEDNT 283
             :|.:||| |:.|||:||  ..|||||.||:.|.|.|
Mouse   258 ASIQRRKKPASQKKRRFK--THNEHLAGVLKDYSDIT 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 50/80 (63%)
Gtf2e2XP_006509248.1 TFIIE_beta_winged_helix 72..150 CDD:153423 50/80 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191736290
eggNOG 1 0.900 E1_COG5174
Hieranoid 1 1.000
Homologene 1 1.000 H37573
Inparanoid 1 1.050 296 1.000 Inparanoid score I2708
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003776
OrthoInspector 1 1.000 T1082597
orthoMCL 1 0.900 OOG5_129561
Panther 1 1.100 LDO PTHR12716
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1465
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.