DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIEbeta and gtf2e2

Sequence 1:NP_523923.1 Gene:TfIIEbeta FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001016555.1 Gene:gtf2e2 XenbaseID:XB-GENE-962385 Length:288 Species:Xenopus tropicalis

Alignment Length:292 Identity:166/293 (57%)
Similarity:208/293 (71%) Gaps:21/293 (7%)


  Fly     1 MDPALLREREAFKKRAMATPTVEKKSKPDRPAPPPPSDDSRR-KMRPP----NAPRLDAT----T 56
            |||||||:||.|||||:.||.|||     ||:....|...:| |:.|.    :.|.||.:    .
 Frog     1 MDPALLRDRELFKKRALTTPAVEK-----RPSASSESSKKKRAKLEPSGTSGSKPSLDGSNGSFN 60

  Fly    57 YKTMSGSSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQSVKNWLASEALHNNP 121
            .|::||||.|:||||||||.:|:||||.||.||||:|||||||..||||...|.||.||||.|||
 Frog    61 LKSLSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGIKQKQWLMSEALVNNP 125

  Fly   122 KVEASPCGTKFSFKPVYKIKDGKTLMRLLKQHDLKGLGGILLDDVQESLPHCEKVLKNRSAEILF 186
            |:|.  ...|::|||.|.:||.|.|:|||.:||.:|||||||:|::|.||:.:|.:|....:|:|
 Frog   126 KIEI--IDGKYAFKPKYNLKDKKALLRLLDKHDQRGLGGILLEDIEEGLPNSQKAIKALGDQIVF 188

  Fly   187 VVRPIDKKKILFYNDRTANFSVDDEFQKLWRSATVDAMDDAKIDEYLEKQGIRSMQDHGLKKAIP 251
            |.|| ||||||||||::..|:||:||||||||..||:|||.||:|||::|||.||||.|.||.||
 Frog   189 VTRP-DKKKILFYNDKSCQFTVDEEFQKLWRSVPVDSMDDEKIEEYLKRQGISSMQDSGPKKIIP 252

  Fly   252 --KRKKAANKKRQFKKPRDNEHLADVLEVYED 281
              ||||..:::|:||  ..|:|||.||:.|.|
 Frog   253 VQKRKKTTSQRRRFK--THNDHLAGVLKDYTD 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 52/80 (65%)
gtf2e2NP_001016555.1 TFIIE_beta_winged_helix 65..143 CDD:153423 52/80 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191738194
eggNOG 1 0.900 E1_COG5174
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H37573
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1160863at2759
OrthoFinder 1 1.000 FOG0003776
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.