DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIEbeta and gtf2e2

Sequence 1:NP_523923.1 Gene:TfIIEbeta FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_997896.1 Gene:gtf2e2 ZFINID:ZDB-GENE-030131-6794 Length:291 Species:Danio rerio

Alignment Length:304 Identity:162/305 (53%)
Similarity:202/305 (66%) Gaps:30/305 (10%)


  Fly     1 MDPALLREREAFKKRAMATPTVE--------------KKSKPDRPAPPPPSDDSRRKMRPPNAPR 51
            ||||||||||.|||||::||.||              ||||||:.:    |..|:....|.|.  
Zfish     1 MDPALLRERELFKKRALSTPAVEKRPAASEASGSSKKKKSKPDKES----SSSSKNNSDPSNG-- 59

  Fly    52 LDATTYKTMSGSSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQSVKNWLASEA 116
              :...|.:||||.|:|||||:||.:|:||||.||.||||::||||||..||||...|.||.|||
Zfish    60 --SFNLKALSGSSGYKFGVLARIVNYMKTRHQRGDTHPLTLEEILDETKLLDIGMKQKQWLMSEA 122

  Fly   117 LHNNPKVEASPCGTKFSFKPVYKIKDGKTLMRLLKQHDLKGLGGILLDDVQESLPHCEKVLKNRS 181
            |.:|||::...  .|::|||.|.:||.|.|:|||.:||..||||:|||||:|.||:..|.:|...
Zfish   123 LASNPKIDVRE--GKYAFKPKYHLKDKKALLRLLDKHDQLGLGGVLLDDVEEGLPNAAKAIKALG 185

  Fly   182 AEILFVVRPIDKKKILFYNDRTANFSVDDEFQKLWRSATVDAMDDAKIDEYLEKQGIRSMQDHGL 246
            .:|:||.|| ||||||||||:...|.||:||||||||..||::|:.||:|||:||||.|||:.|.
Zfish   186 DQIIFVTRP-DKKKILFYNDKHCQFVVDEEFQKLWRSVPVDSIDEEKIEEYLKKQGISSMQETGP 249

  Fly   247 KKAIP--KRKK-AANKKRQFKKPRDNEHLADVLEVYEDNTLTLK 287
            ||..|  |||| ...:||::|  ..|:||..|||.|.|...:.|
Zfish   250 KKMTPIQKRKKPGTQRKRRYK--THNDHLNGVLEDYFDGVPSKK 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 48/80 (60%)
gtf2e2NP_997896.1 TFIIE_beta_winged_helix 67..145 CDD:153423 48/80 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191736147
eggNOG 1 0.900 E1_COG5174
Hieranoid 1 1.000
Homologene 1 1.000 H37573
Inparanoid 1 1.050 289 1.000 Inparanoid score I2740
OMA 1 1.010
OrthoDB 1 1.010 D1160863at2759
OrthoFinder 1 1.000 FOG0003776
OrthoInspector 1 1.000 T1051948
orthoMCL 1 0.900 OOG5_129561
Panther 1 1.100 LDO PTHR12716
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1465
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.