DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIEbeta and Gtf2e2

Sequence 1:NP_523923.1 Gene:TfIIEbeta FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001100788.2 Gene:Gtf2e2 RGDID:1310134 Length:291 Species:Rattus norvegicus

Alignment Length:297 Identity:163/298 (55%)
Similarity:209/298 (70%) Gaps:23/298 (8%)


  Fly     1 MDPALLREREAFKKRAMATPTVEKKSKPDRPAPPPPSDDSRRKM----------RPPNAPRLDAT 55
            |||:|||:||.|||||::||.|||::.|..    .||..|::|.          ...|:...:.:
  Rat     1 MDPSLLRDRELFKKRALSTPVVEKRAVPSE----SPSSSSKKKKAKVEHGGSSGSKQNSDHNNGS 61

  Fly    56 -TYKTMSGSSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQSVKNWLASEALHN 119
             ..|.:||||.|:||||||||.:|:||||.||.||||::||||||..||||...|.||.:|||.|
  Rat    62 FNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLEEILDETQHLDIGLKQKQWLMTEALVN 126

  Fly   120 NPKVEASPCGTKFSFKPVYKIKDGKTLMRLLKQHDLKGLGGILLDDVQESLPHCEKVLKNRSAEI 184
            |||:|.  ...|::|||.|.:||.|.|:|||..||.:|||||||:|::|.||:.:|.:|....:|
  Rat   127 NPKIEV--VDGKYAFKPKYNLKDKKALLRLLDNHDQRGLGGILLEDIEEGLPNSQKAVKALGDQI 189

  Fly   185 LFVVRPIDKKKILFYNDRTANFSVDDEFQKLWRSATVDAMDDAKIDEYLEKQGIRSMQDHGLKK- 248
            |||.|| |||||||:||::..||||:||||||||.|||:||:.||:|||::|||.|||:.|.|| 
  Rat   190 LFVSRP-DKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKV 253

  Fly   249 -AIPKRKK-AANKKRQFKKPRDNEHLADVLEVYEDNT 283
             :|.:||| |:.|||:||  ..|||||.||:.|.|.|
  Rat   254 ASIQRRKKPASQKKRRFK--THNEHLAGVLKDYSDIT 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 50/80 (63%)
Gtf2e2NP_001100788.2 TFIIE_beta_winged_helix 68..146 CDD:153423 50/80 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191738716
eggNOG 1 0.900 E1_COG5174
Hieranoid 1 1.000
Homologene 1 1.000 H37573
Inparanoid 1 1.050 296 1.000 Inparanoid score I2605
OMA 1 1.010
OrthoDB 1 1.010 D1160863at2759
OrthoFinder 1 1.000 FOG0003776
OrthoInspector 1 1.000 T1086187
orthoMCL 1 0.900 OOG5_129561
Panther 1 1.100 LDO PTHR12716
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.