DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIEbeta and GTF2E2

Sequence 1:NP_523923.1 Gene:TfIIEbeta FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_002086.1 Gene:GTF2E2 HGNCID:4651 Length:291 Species:Homo sapiens

Alignment Length:298 Identity:163/299 (55%)
Similarity:208/299 (70%) Gaps:25/299 (8%)


  Fly     1 MDPALLREREAFKKRAMATPTVEKKSKPDRPAPPPPSDDSRRKMR-----------PPNAPRLDA 54
            |||:||||||.|||||::||.|||:|     |....|..|.:|.:           ..|:...:.
Human     1 MDPSLLRERELFKKRALSTPVVEKRS-----ASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNG 60

  Fly    55 T-TYKTMSGSSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQSVKNWLASEALH 118
            : ..|.:||||.|:||||||||.:|:||||.||.||||:|||||||..||||...|.||.:|||.
Human    61 SFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALV 125

  Fly   119 NNPKVEASPCGTKFSFKPVYKIKDGKTLMRLLKQHDLKGLGGILLDDVQESLPHCEKVLKNRSAE 183
            ||||:|.  ...|::|||.|.::|.|.|:|||.|||.:|||||||:|::|:||:.:|.:|....:
Human   126 NNPKIEV--IDGKYAFKPKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQ 188

  Fly   184 ILFVVRPIDKKKILFYNDRTANFSVDDEFQKLWRSATVDAMDDAKIDEYLEKQGIRSMQDHGLKK 248
            ||||.|| |||||||:||::..||||:||||||||.|||:||:.||:|||::|||.|||:.|.||
Human   189 ILFVNRP-DKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKK 252

  Fly   249 AIP---KRKKAANKKRQFKKPRDNEHLADVLEVYEDNT 283
            ..|   ::|.|:.|||:||  ..|||||.||:.|.|.|
Human   253 VAPIQRRKKPASQKKRRFK--THNEHLAGVLKDYSDIT 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 51/80 (64%)
GTF2E2NP_002086.1 TFIIE_beta_winged_helix 68..146 CDD:153423 51/80 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191740167
eggNOG 1 0.900 E1_COG5174
Hieranoid 1 1.000
Homologene 1 1.000 H37573
Inparanoid 1 1.050 298 1.000 Inparanoid score I2683
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1160863at2759
OrthoFinder 1 1.000 FOG0003776
OrthoInspector 1 1.000 T1072530
orthoMCL 1 0.900 OOG5_129561
Panther 1 1.100 LDO PTHR12716
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1465
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.