DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIEbeta and tfa2

Sequence 1:NP_523923.1 Gene:TfIIEbeta FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_587879.1 Gene:tfa2 PomBaseID:SPCC1672.08c Length:285 Species:Schizosaccharomyces pombe

Alignment Length:309 Identity:69/310 (22%)
Similarity:130/310 (42%) Gaps:64/310 (21%)


  Fly     4 ALLREREAFKKRAMATPTVEKKSKPDRPAPPPP------SDDSRRKMRPPNAPRLDATTYKTM-- 60
            :|..:..:|||: :|...:..|.:|.:||.|.|      :|........|.:..|.....||.  
pombe     3 SLSDQLSSFKKK-VANQPIYAKPQPRQPASPTPTAYLNSNDGHSSAASSPGSYSLKKKRSKTSLV 66

  Fly    61 ------SGSSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQSVKNWLAS----- 114
                  ||...:....|...|::::.|::     |.|.:||             .::|::     
pombe    67 YSQPADSGVGTHYLSQLHYAVEYLKERNE-----PKTAEEI-------------ASYLSTPLTPM 113

  Fly   115 --EALHNNPKVEASPCGTKFSFKPVYKIKDGKTLMRLL---KQHDLKGLGGILLDDVQESLPHCE 174
              ..|..|.::........|:|||::.|:.|..|:..|   |.|     .|:.:.::::..|:..
pombe   114 LLNLLKKNNRIYYDERNETFTFKPLHNIRSGAGLLAYLDSQKTH-----VGMSIKELRDGWPNVT 173

  Fly   175 KVLK--NRSAEILFV-VRPIDKKKILFYNDRTANFSVDDEFQKLWRSATVDAMDDAKIDEYLEKQ 236
            ..|:  .:..|:|.: .|.....|:::.||::.:..||.|||::|....:....|  :...|.|.
pombe   174 VELEELEKQGEVLLLRTRKDGVPKMVWRNDKSCDCHVDKEFQQVWHEIPIPPTLD--LASELGKY 236

  Fly   237 GIR--SMQDHGLKKA----IPKRKKAANKKRQFKKPRDNEHLADVLEVY 279
            |::  |:....:|:|    .||:||...::.:.    .|.|| ::|..|
pombe   237 GLKPTSVDPSTVKRAGHNQTPKQKKPKTRRGKI----TNTHL-NILRDY 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 17/87 (20%)
tfa2NP_587879.1 TFA2 1..284 CDD:227501 69/310 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2026
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003776
OrthoInspector 1 1.000 T1124392
orthoMCL 1 0.900 OOG5_129561
Panther 1 1.100 LDO PTHR12716
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1465
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.