DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TfIIEbeta and gtf-2E2

Sequence 1:NP_523923.1 Gene:TfIIEbeta FlyBaseID:FBgn0015829 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_496466.1 Gene:gtf-2E2 WormBaseID:WBGene00010054 Length:289 Species:Caenorhabditis elegans

Alignment Length:299 Identity:105/300 (35%)
Similarity:169/300 (56%) Gaps:29/300 (10%)


  Fly     1 MDPALLREREAFKKRAMATPTVEKKSKPDRPAPPP------PSDDSRRKMRPPNAPRLDATTYKT 59
            |||.|||:|.||:|.|..|..|:.|     |...|      .|:.::.|.:..:.|..:.:....
 Worm     1 MDPELLRQRTAFQKHAATTMAVQNK-----PTTAPNSHTTYSSEAAKAKKKKSSGPAQNLSKLPD 60

  Fly    60 MSG--------SSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQSVKNWLASEA 116
            .:.        |:...|..:||||.:|:.||.:....|||:.|||||....|:.:....:| .||
 Worm    61 FNNSVSNANALSNATNFSTMAKIVDYMKKRHLNNQQWPLTLQEILDELQIFDLSKRSLAFL-QEA 124

  Fly   117 LHNNPKVEASPCGTKFSFKPVYKIKDGKTLMRLLKQHDLKGLGGILLDDVQESLPHCEKVLKNRS 181
            |.|||::...  ..||:|:|.||||...:|:.:.::|...|.||||:.|:.|.:.:.:.:|:..|
 Worm   125 LPNNPRLIME--SEKFAFRPPYKIKGKTSLVAVARKHYQDGKGGILVSDLAECVANYDALLQQVS 187

  Fly   182 AEILFVVRPIDKKK--ILFYNDRTANF-SVDDEFQKLWRSATVDAMDDAKIDEYLEKQGIRSMQD 243
            :|::.|...::|||  ::||||:...| .::|:|:.|||..:||.:|:.||:|||:|:|:.:|:|
 Worm   188 SEVIVVPTQVNKKKDRVVFYNDKEFTFPELEDDFKALWRHVSVDHLDEKKIEEYLQKKGLDAMKD 252

  Fly   244 --HGLKKAIPKRKKAANKKRQFKKPRDNEHLADVLEVYE 280
              ..::...|.::|||  ||:|.:...|||:..|||.||
 Worm   253 LTPKVRMQAPLKRKAA--KRRFNQKVQNEHMDGVLEDYE 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TfIIEbetaNP_523923.1 TFIIE_beta_winged_helix 61..141 CDD:153423 32/88 (36%)
gtf-2E2NP_496466.1 TFIIE_beta_winged_helix 70..147 CDD:153423 32/80 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191729028
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H37573
Inparanoid 1 1.050 166 1.000 Inparanoid score I2760
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1160863at2759
OrthoFinder 1 1.000 FOG0003776
OrthoInspector 1 1.000 T475246
orthoMCL 1 0.900 OOG5_129561
Panther 1 1.100 LDO PTHR12716
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1465
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.