DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and RBP45A

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_568815.1 Gene:RBP45A AraportID:AT5G54900 Length:387 Species:Arabidopsis thaliana

Alignment Length:443 Identity:81/444 (18%)
Similarity:141/444 (32%) Gaps:169/444 (38%)


  Fly    13 GRGGQEYSNDDDPPMSRLFIICNKAHTEEDF-REAFSPYGEIEDIWVVKDKHTQENKGIAYVKFS 76
            |.|.|...:..|  :..|:|...:...:|:: ...|:..||.....|:::|.|.:::|..:::|.
plant    47 GIGSQNPGSASD--VKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFV 109

  Fly    77 KTSDAAKAQEEMNGKTIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFI--VIPKTATEEDIR 139
            ..|.|.:..:..||..:...::|.: |..|....|..:.:.|...:. :|:  :.|: .|:..:.
plant   110 SHSVAERVLQTYNGAPMPSTEQTFR-LNWAQAGAGEKRFQTEGPDHT-IFVGDLAPE-VTDYMLS 171

  Fly   140 EEFSQ-WGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQRD 203
            :.|.. :|.|:...:|.::..|..||:|:|||                                 
plant   172 DTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRF--------------------------------- 203

  Fly   204 QYGRPSEDNPLYSSSGRGNSNFNGGGSSSGGGGSNSYNNDWNVSQNNDMAAFLRMQNVPVAQPSC 268
                                                      ..:|..|.|...|..        
plant   204 ------------------------------------------ADENEQMRAMTEMNG-------- 218

  Fly   269 LEVNVSNCVNQDQLWRLFDIIPGLDYCQI--MREHGPRTNEALVVYDNPEAAIYAKDKLHGLEYP 331
                                    .||..  || .||..|               |:.|     |
plant   219 ------------------------QYCSTRPMR-IGPAAN---------------KNAL-----P 238

  Fly   332 MGERIIVKVNGMSSARMDTSFIDKRTKKDAICNVPLPPTQPLASPDDQVAQRLFI-VLSANLPHS 395
            |...:.....|.:                             |..:|.....:|: .|.||:...
plant   239 MQPAMYQNTQGAN-----------------------------AGDNDPNNTTIFVGGLDANVTDD 274

  Fly   396 ILKNIFSCWSGLIDVYLLPNKNCGYVKYAEVESAQLAIRTLNGAEICGTKIKV 448
            .||:||..:..|:.|.:.|.|.||:|:||...||:.|:..|||.::.|..|::
plant   275 ELKSIFGQFGELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQLGGQSIRL 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 17/81 (21%)
RRM2_RBM45 122..195 CDD:240813 14/76 (18%)
RRM3_RBM45 267..339 CDD:240814 11/74 (15%)
RRM4_RBM45 383..449 CDD:240815 25/68 (37%)
RBP45ANP_568815.1 ELAV_HUD_SF 61..336 CDD:273741 77/428 (18%)
RRM1_SECp43_like 61..138 CDD:240790 17/78 (22%)
RRM2_SECp43_like 153..232 CDD:240791 24/189 (13%)
RRM3_NGR1_NAM8_like 259..330 CDD:240792 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.