DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and rbm45

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001120874.1 Gene:rbm45 ZFINID:ZDB-GENE-070122-4 Length:467 Species:Danio rerio

Alignment Length:468 Identity:171/469 (36%)
Similarity:272/469 (58%) Gaps:63/469 (13%)


  Fly    23 DDPPMSRLFIICNKAHTEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEE 87
            |:||.||||::.:|:.||:..||:|:.:|||:||||||||.|:|:||:|::||:|:|.|..|.||
Zfish    12 DEPPNSRLFLVTSKSITEDTIRESFASFGEIQDIWVVKDKQTKESKGVAFIKFAKSSQACTAMEE 76

  Fly    88 MNGKTIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFIVIPKTATEEDIREEFSQWGDVESVT 152
            |:|:.:.:..:.:||.:|.:|:.||:: :.|.|:..|:|::||||.||:|::|.|..:||:|...
Zfish    77 MHGRCLAEGTKPIKVFIAQSRSSGSHR-DVEDEELTRIFVMIPKTFTEDDLKETFKVYGDIEYAI 140

  Fly   153 IVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPK-GSTRTQRDQYGRPSEDNPLYS 216
            |::.|..|:.||.|||||.|...||.|.|||...::|:.|||: .::....|.:..|....  :|
Zfish   141 IIRNKTTGDSKGLGYVRFHKPSQAAKAVENCDKTFRAIIAEPRTKNSSADNDYFSNPRTTE--HS 203

  Fly   217 SSGRGNSNFNGGGSSSGGGGSNSYNNDWNVSQNNDMAAFLRMQNVPVAQPSCLEVNVSNCVNQDQ 281
            :|..|:|::.....||....:.||::|                    ....||.|:....|:|:|
Zfish   204 TSELGSSSYAFAQESSSYSAAESYSSD--------------------IITRCLMVSSRVSVSQEQ 248

  Fly   282 LWRLFDIIPGLDYCQIMR-EHGPRTNEALVVYDNPEAAIYAKDKLHGLEYPMGERIIVKV----- 340
            ::.|||:|||||||:|.| ::|....:.:|.|.|..:|:|||:||:|.|||.|.|:.|..     
Zfish   249 IYSLFDLIPGLDYCEIQRDQYGFSKGQVVVRYSNLGSAVYAKEKLNGFEYPPGNRLSVSFVDDGE 313

  Fly   341 -----------------------NGMSSAR-MDTSF------IDKRTKKDAICNVPLPPTQPLAS 375
                                   ||.|.:: |.||.      :.::.:.....|:|.|  :.|.:
Zfish   314 DRTSPVGKMAMQLVAAQMMSMVWNGPSGSQLMKTSAGYTAPPVPQKARLQTDANLPAP--KKLLA 376

  Fly   376 PDDQVAQRLFIVLSAN-LPHSILKNIFSCWSGLIDVYLLPNKNCGYVKYAEVESAQLAIRTLNGA 439
            .|..|.:|||::.:.: ||..:|:::|..:..||:|||:|.:|.||:|||:..||..||.|::|.
Zfish   377 LDSVVKERLFVIFNPSPLPVEVLEDVFCRFGSLIEVYLVPGRNVGYIKYADRRSAHDAIDTMHGK 441

  Fly   440 EICGTKIKVMEAE 452
            .:.|.|:|||.|:
Zfish   442 VVNGVKMKVMLAD 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 40/80 (50%)
RRM2_RBM45 122..195 CDD:240813 35/73 (48%)
RRM3_RBM45 267..339 CDD:240814 35/73 (48%)
RRM4_RBM45 383..449 CDD:240815 29/67 (43%)
rbm45NP_001120874.1 RRM1_RBM45 14..94 CDD:240812 40/80 (50%)
RRM2_RBM45 110..183 CDD:240813 35/73 (48%)
RRM3_RBM45 234..307 CDD:240814 35/73 (48%)
RRM4_RBM45 384..451 CDD:240815 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C209030870
eggNOG 1 0.900 E1_2CAJT
Hieranoid 1 1.000
Homologene 1 1.000 H15560
Inparanoid 1 1.050 297 1.000 Inparanoid score I2665
OMA 1 1.010
OrthoDB 1 1.010 D299261at33208
OrthoFinder 1 1.000 FOG0007390
OrthoInspector 1 1.000 T1054452
orthoMCL 1 0.900 OOG5_134620
Panther 1 1.100 LDO PTHR10352
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5751
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.