DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and mod

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001247401.1 Gene:mod FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster

Alignment Length:223 Identity:50/224 (22%)
Similarity:92/224 (41%) Gaps:57/224 (25%)


  Fly    35 NKAHTEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRT 99
            :::::.:...:.|..:|::|:|.||..|..     :|:|.|.::..|.||..:::|||:.|.:..
  Fly   350 HESYSSDALEKIFKKFGDVEEIDVVCSKAV-----LAFVTFKQSDAATKALAQLDGKTVNKFEWK 409

  Fly   100 LKVLVAANRNQGSNKSENEQEKYVRLFIVIPKTATEEDIREEFSQWGDVESV------TIVKEKN 158
            |            ::.|........|...:...|||.|:|:.|:..|::||:      .:||.|:
  Fly   410 L------------H
RFERSTSGRAILVTNLTSDATEADLRKVFNDSGEIESIIMLGQKAVVKFKD 462

  Fly   159 NGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPK--------------GSTRTQRDQYGRPS 209
            :..        |.|.:.|..:..|.:    .:|.||.              |.||..| ::.:.:
  Fly   463 DEG--------FCKSFLANESIVNNA----PIFIEPNSLLKHRLLKKRLAIGQTRAPR-KFQKDT 514

  Fly   210 EDNPLYSSSGRGNSNFNGGGSSSGGGGS 237
            :.|       .|...||...:...||.|
  Fly   515 KPN-------FGKKPFNKRPAQENGGKS 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 18/70 (26%)
RRM2_RBM45 122..195 CDD:240813 20/79 (25%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
modNP_001247401.1 RRM_SF 177..244 CDD:302621
RRM_SF 260..327 CDD:240668
RRM_SF 342..411 CDD:240668 18/78 (23%)
RRM_SF 422..>465 CDD:302621 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70786681
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.