| Sequence 1: | NP_647887.1 | Gene: | CG1316 / 38526 | FlyBaseID: | FBgn0035526 | Length: | 470 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_651755.2 | Gene: | CG7903 / 43554 | FlyBaseID: | FBgn0039730 | Length: | 384 | Species: | Drosophila melanogaster |
| Alignment Length: | 255 | Identity: | 65/255 - (25%) |
|---|---|---|---|
| Similarity: | 93/255 - (36%) | Gaps: | 86/255 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 EDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVA 105
Fly 106 ANRNQ---------------------------GSNKSENEQE-KYVRLFIVIPKTATEEDIREEF 142
Fly 143 SQWGDVESVTIVKEKNNGNPKGFGYVRFTKFY-------YAAVAFENCSAK----YKAVFA---- 192
Fly 193 -------EPK-GSTR-TQRDQYG-----RPSEDNPLYSSSGRG-NSNFNGGGSSSGGGGS 237 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1316 | NP_647887.1 | RRM1_RBM45 | 25..105 | CDD:240812 | 17/63 (27%) |
| RRM2_RBM45 | 122..195 | CDD:240813 | 18/94 (19%) | ||
| RRM3_RBM45 | 267..339 | CDD:240814 | |||
| RRM4_RBM45 | 383..449 | CDD:240815 | |||
| CG7903 | NP_651755.2 | RRM | <4..168 | CDD:223796 | 37/177 (21%) |
| RRM_SF | 6..70 | CDD:302621 | 17/63 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45439657 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||