DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and eIF3g2

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_650887.1 Gene:eIF3g2 FlyBaseID:FBgn0038796 Length:273 Species:Drosophila melanogaster

Alignment Length:160 Identity:36/161 (22%)
Similarity:62/161 (39%) Gaps:40/161 (25%)


  Fly    33 ICNKAHTEEDFREAFSPYGEIEDIWVVKDKH---TQENKGIAYVKFSKTSDAAKAQEEMNGKTI- 93
            |||..|                  |.|...:   :.::|.:...|.:..:.||.:.....||.: 
  Fly   122 ICNGEH------------------WSVNCPYKGTSMDSKTVMETKANAAAAAAISDPSKTGKYVP 168

  Fly    94 -------GKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFIVIPKTATEEDIREEFSQWGDVESV 151
                   |         ::.::|.|..: :.:....||: ..:.::.||.|:.|...:.|....:
  Fly   169 PFMKDGGG---------ISGSKNWGRGR-DRDDSSAVRI-SNLSESMTETDLEELVKKIGPHTKM 222

  Fly   152 TIVKEKNNGNPKGFGYVRFTKFYYAAVAFE 181
            .:.:|||:|..|||.||.|.....||.|.|
  Fly   223 YLAREKNSGLCKGFAYVHFKFRQDAAAAIE 252

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 13/83 (16%)
RRM2_RBM45 122..195 CDD:240813 21/61 (34%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
eIF3g2NP_650887.1 eIF3g 28..137 CDD:289149 6/33 (18%)
RRM <171..>256 CDD:223796 24/94 (26%)
RRM_eIF3G_like 194..270 CDD:240854 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10352
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.