DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and CG7804

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001261874.1 Gene:CG7804 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster

Alignment Length:194 Identity:50/195 (26%)
Similarity:83/195 (43%) Gaps:34/195 (17%)


  Fly    39 TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVL 103
            ||:|.||.|..||::....:.||..:..:||..:|:|.    :...|..:..|......|..:|.
  Fly   119 TEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFG----SYDVQMHVLSKRHSIDGRWCEVK 179

  Fly   104 VAANRNQGSNKSENEQEKYVRLFIVIPKTATE----EDIREEFSQWGDVESVTIVKEKNNGNP-K 163
            |.|:|..|:.:..       ::|:   ...||    :|:||.||::|:|..|.|.|      | :
  Fly   180 VPASR
GMGNQEPG-------KVFV---GRCTEDIEADDLREYFSKFGEVIDVFIPK------PFR 228

  Fly   164 GFGYVRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQRDQYGRPSEDNPLYSSSGRGN--SNF 225
            .|.:|.|...|...|.   |..|:.........||..:::...:    |.|:.::...|  :||
  Fly   229 AFSFVTFLDPYVPRVV---CGEKHIIKGVSVHVSTADKKNVQNK----NQLFQTNNYNNLDNNF 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 19/66 (29%)
RRM2_RBM45 122..195 CDD:240813 21/78 (27%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
CG7804NP_001261874.1 RRM1_TDP43 108..184 CDD:240767 20/69 (29%)
RRM2_TDP43 193..262 CDD:240768 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70820001
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.