DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and shep

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001246636.1 Gene:shep FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster

Alignment Length:418 Identity:85/419 (20%)
Similarity:141/419 (34%) Gaps:119/419 (28%)


  Fly    14 RGGQEYSNDDDPPMSRLFII-CNKAHTEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSK 77
            :||::.|.      :.|:|. ..:..|::|.....:.||.|.....:.||.|.:.||..:|.|.:
  Fly   235 QGGEQLSK------TNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQ 293

  Fly    78 TSDAAKAQEEMNGKTIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFIV-IPKTATEEDIREE 141
            .:.|..|.:.:.||.:                |.....:.||:. ..|:|. :|....|.|:...
  Fly   294 PAFAECAVKGLQGKGV----------------QAQMAKQQEQDP-TNLYIANLPPHFKETDLEAM 341

  Fly   142 FSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYA-------------------AVAFENCSAKY 187
            .|::|.|.|..|::::.. |.||.|:.|.......                   .|.|.:...|.
  Fly   342 LSKYGQVVSTRILRDQQM-NSKGVGFARMESREKCEQIIQMFNGNTIPGAKDPLLVKFADGGPKK 405

  Fly   188 KAVFAEPKGSTRTQRD--QYGRPSEDNPLYSSSGRGNSNFNGGG---------SSSGGGGSNSYN 241
            |.:|..|..:.|..||  ..|.|...:|....:|   .:.|.|.         |:...||.....
  Fly   406 KNLFKTPDPNARAWRDVSAEGIPVAYDPTMQQNG---VSVNVGTPIGVPYSRFSAPQVGGYPVAG 467

  Fly   242 NDW----NVSQNNDMAAFL-RMQNVPVAQPSCLEVNVSNCVNQDQLWRLFDIIPGLDYCQIMREH 301
            :.|    .::|.:|..::. :...:..|.|..:.......|||.|                    
  Fly   468 SQWIPGYMMTQVDDQTSYSPQYMQMAAAPPLGVTSYKPEAVNQVQ-------------------- 512

  Fly   302 GPRTNEALVVYDNPEAAIYAKDKLHGLEYPMGERIIVKVNGMSSARMDTSFIDKRTKKDAICNVP 366
             ||....:|..|.            |:.|.      ..:..:::.::..|:|.......|    |
  Fly   513 -PRGISMMVSGDT------------GVPYG------TMMPQLATLQIGNSYISPTYPYYA----P 554

  Fly   367 LP---PTQPL---------ASPDDQVAQ 382
            .|   ||.|:         ||||:...|
  Fly   555 PPTIIPTMPMTDSEQASTAASPDEAYTQ 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 18/81 (22%)
RRM2_RBM45 122..195 CDD:240813 21/93 (23%)
RRM3_RBM45 267..339 CDD:240814 10/72 (14%)
RRM4_RBM45 383..449 CDD:240815 85/419 (20%)
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 19/86 (22%)
RRM2_MSSP 322..400 CDD:240690 17/79 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70593778
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.