DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and TBPH

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001163280.1 Gene:TBPH FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster

Alignment Length:399 Identity:83/400 (21%)
Similarity:122/400 (31%) Gaps:170/400 (43%)


  Fly    39 TEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVL 103
            |||..||.|..|||:....:.||..:.::||..:|:|                  |..|..::||
  Fly   119 TEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRF------------------GSYDAQMRVL 165

  Fly   104 VAANRNQG--------SNKSENEQEKYVRLFIVIPKTATE----EDIREEFSQWGDVESVTIVKE 156
            ...:...|        ::|....|.. .::|:   ...||    :|:||.||::|:|..|.|   
  Fly   166 TNRHLIDGRWCEVKVPNSK
GMGHQVP-CKVFV---GRCTEDINSDDLREYFSKFGEVTDVFI--- 223

  Fly   157 KNNGNPKGFGYVRFTKFYYAAVAFENCSAKY--KAVF-----AEPKG-STRTQRDQY-------- 205
                 |:.|....|..|....||...|...:  |.|.     |.||. ..|.|:.|.        
  Fly   224 -----PRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANS 283

  Fly   206 ---------------GR--------------------PSEDNPLYSSSGRGNSNF---------- 225
                           ||                    |:..|...:..|.|.:|:          
  Fly   284 FGMHSYHPQGNHMNPGRNGHHRGNNQHNAHGGENAIVPNNHNIGTAGYGMGGNNYGGNSGGGYHN 348

  Fly   226 NGGGSSSGGG-----GSNSYN--------------------NDW--------------------- 244
            |||..||||.     |.:.||                    |.|                     
  Fly   349 NGGNHSSGGNTNRQDGGSQYNSRQSNFHGMNQPHNGNVGGSNGWMNRGHLDMPNLQALGINSQGS 413

  Fly   245 ---NVSQNNDMAAFLRMQNVPVAQPSCLEV---------NVSNCVNQDQLWRLFDIIPGLDYCQI 297
               |..||....:.|.:.::|: .|:.:..         |.....||||        .|.::...
  Fly   414 SSSNQGQNMSNQSMLNLNSLPI-NPALVAAALNQWSLVGNQLQNQNQDQ--------QGGNFLSW 469

  Fly   298 MREHGPRTN 306
            |.::|...|
  Fly   470 MAQNGGHNN 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 19/66 (29%)
RRM2_RBM45 122..195 CDD:240813 23/84 (27%)
RRM3_RBM45 267..339 CDD:240814 9/50 (18%)
RRM4_RBM45 383..449 CDD:240815
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 20/83 (24%)
RRM2_TDP43 192..261 CDD:240768 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70819923
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.