DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and Rbp9

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001259974.1 Gene:Rbp9 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster

Alignment Length:372 Identity:82/373 (22%)
Similarity:161/373 (43%) Gaps:51/373 (14%)


  Fly    20 SNDDDPPMSRLFIICNKAHTEEDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKA 84
            :|:.||..:.:.....:..::::.|..|..:||:|...:::||.|.::.|..:|.:.|..||.||
  Fly   103 NNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVKQEDAEKA 167

  Fly    85 QEEMNGKTIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFIV-IPKTATEEDIREEFSQWGDV 148
            ...:||..:  .::|:||.:|        :..:|..|...|::. :||..|:.|:...||.:|.:
  Fly   168 INALNGLRL--QNKTIKVSIA--------RPSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKI 222

  Fly   149 ESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPKGSTRTQRDQYGRPSEDN- 212
            .:..|:.:...|..||.|::||.:.:.|..|.:..:.      ..||.||.....::......| 
  Fly   223 ITSRILCDNITGLSKGVGFIRFDQRFEADRAIKELNG------TTPKNSTEPITVKFANNPSSNK 281

  Fly   213 -----------PLYSSSGRGNSNFNGGGSSSGGGGSNSYNNDWNVSQ--------NNDMAAFLRM 258
                       |..:..||........|:::....:..:.|....|.        .:|:.....:
  Fly   282 NSMQPLAAYIAPQNTRGGRAFPANAAAGAAAAAAAAAIHPNAGRYSSVISRYSPLTSDLITNGMI 346

  Fly   259 QNVPVAQPS-CLEV-NVSNCVNQDQLWRLFDIIPGLDYCQIMREHGPRTNE----ALVVYDNPEA 317
            |...:|... |:.| |::....::.||:||.....:...:::|:  .::|:    ..|...|.|.
  Fly   347 QGNTIASSGWCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRD--LQSNKCKGFGFVTMTNYEE 409

  Fly   318 AIYAKDKLHGLEYPMGERIIVKVNGMSSARMDTSFIDKRTKKDAICN 364
            |:.|...|:|  |.:|.|:: :|:..::....| .:   ||..|:.|
  Fly   410 AVLAIQSLNG--YTLGNRVL-QVSFKTNKNKQTXLL---TKLAAVVN 450

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 21/80 (26%)
RRM2_RBM45 122..195 CDD:240813 18/74 (24%)
RRM3_RBM45 267..339 CDD:240814 19/78 (24%)
RRM4_RBM45 383..449 CDD:240815
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 76/352 (22%)
RRM1_Hu 109..186 CDD:241094 20/79 (25%)
RRM2_Hu 196..274 CDD:241096 21/84 (25%)
RRM3_Hu 355..432 CDD:240823 20/82 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69449229
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10352
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.