powered by:
Protein Alignment CG1316 and Spx
DIOPT Version :9
| Sequence 1: | NP_647887.1 |
Gene: | CG1316 / 38526 |
FlyBaseID: | FBgn0035526 |
Length: | 470 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_511058.1 |
Gene: | Spx / 31558 |
FlyBaseID: | FBgn0015818 |
Length: | 347 |
Species: | Drosophila melanogaster |
| Alignment Length: | 149 |
Identity: | 37/149 - (24%) |
| Similarity: | 64/149 - (42%) |
Gaps: | 19/149 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 EAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNG-KTIGKMDRTLKVLV-AAN 107
|.|...|.:.::.:.||:.||.::|..:|:|....||....:.||. |..||..|..|... ..|
Fly 31 ELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLYGKPIRVNKASAHQKN 95
Fly 108 RNQGSNKSENEQEKYVRLFIVIPKTATEED---IREEFSQWGDV-ESVTIVKEKNNGNPKGFGYV 168
.:.|:| |.|.....|.| :.:.||.:|.: ::..|:::...|..|.|.::
Fly 96 LDVGAN-------------IFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFI 147
Fly 169 RFTKFYYAAVAFENCSAKY 187
.|..|..:..|.:..:.:|
Fly 148 NFASFEASDAAMDAMNGQY 166
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45439633 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.