DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and Rbm45

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_695218.1 Gene:Rbm45 RGDID:628862 Length:476 Species:Rattus norvegicus

Alignment Length:493 Identity:181/494 (37%)
Similarity:271/494 (55%) Gaps:71/494 (14%)


  Fly     1 MSDYRSQSRSGGGRGGQEYSNDDDPPMSRLFIICNKAHTEEDFREAFSPYGEIEDIWVVKDKHTQ 65
            |.|..|...|||.|.|.:  :.|:||.||:|::.:|..:|...||.|||:|:|:|||||:||||:
  Rat     1 MDDAGSSGGSGGFRPGVD--SLDEPPNSRIFLVISKYTSESVLREHFSPFGDIQDIWVVRDKHTK 63

  Fly    66 ENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMD-RTLKVLVAANRNQGSNKSENEQEKYVRLFIVI 129
            |:||||:|||:::|.|.:|.|||:|:.:|..| :.:||.:|.:|:.||:: :.|.|:..|:|::|
  Rat    64 ESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHR-DVEDEELTRIFVMI 127

  Fly   130 PKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEP 194
            ||:.||||:||:|..:||:|..:::|.|..|..||.||||:.|...||.|.|||...::|:.|||
  Rat   128 PKSYTEEDLREKFKVYGDIEYCSVIKNKVTGESKGLGYVRYLKPSQAAQAIENCDRSFRALLAEP 192

  Fly   195 KGST--RTQRDQY--------GRPSEDNPLYSSSGRGNSNFNGGGSSSGGGGSNSYNNDWNVSQN 249
            |...  ..::|.|        |.....| |:...|...|.|:              ..|.|.|:.
  Rat   193 KNKVLESPEQDYYSSVRQETLGHEPRGN-LFPFVGEQQSEFS--------------TFDKNDSRG 242

  Fly   250 NDMAAFLRMQNVPVAQPSCLEVNVSNCVNQDQLWRLFDIIPGLDYCQIMREHGPRTNEALVVYDN 314
            .:  |..:..:|....|          ..::||:.:|||:|||:||::.|:........:|.|.|
  Rat   243 QE--AISKRLSVASRVP----------FTEEQLFSIFDIVPGLEYCEVHRDPYLNYGHGVVQYFN 295

  Fly   315 PEAAIYAKDKLHGLEYPMGERIIVKV--NGMSSA----RMDTSFIDKRTKKDAICN--------- 364
            ..:|:||:.||||.:||.|.||.|..  :|.:||    :|.|..:..:.......|         
  Rat   296 VASAVYAQYKLHGFQYPPGNRIAVSFLDDGSNSADLIRKMATQMVAAQLASTVWSNPSHQQFLQF 360

  Fly   365 --------------VPLPPTQPLASPDDQVAQRLFIVLSAN-LPHSILKNIFSCWSGLIDVYLLP 414
                          |.||..:..|.|:..|.:|||||.:.: ||..:|::||..:..||:|||:.
  Rat   361 GGSAGSQVPQIQTDVVLPSCRKKAPPETPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIEVYLVS 425

  Fly   415 NKNCGYVKYAEVESAQLAIRTLNGAEICGTKIKVMEAE 452
            .||.||||||:..||..||.||:|..:.|.::|||.|:
  Rat   426 GKNVGYVKYADRMSANDAITTLHGKILNGVRLKVMLAD 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 42/81 (52%)
RRM2_RBM45 122..195 CDD:240813 35/73 (48%)
RRM3_RBM45 267..339 CDD:240814 27/72 (38%)
RRM4_RBM45 383..449 CDD:240815 33/67 (49%)
Rbm45NP_695218.1 RRM1_RBM45 23..104 CDD:240812 42/81 (52%)
RRM2_RBM45 120..193 CDD:240813 35/73 (48%)
RRM3_RBM45 248..320 CDD:240814 29/82 (35%)
RRM4_RBM45 393..460 CDD:240815 33/67 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C209030643
eggNOG 1 0.900 E1_2CAJT
Hieranoid 1 1.000
Homologene 1 1.000 H15560
Inparanoid 1 1.050 284 1.000 Inparanoid score I2731
OMA 1 1.010
OrthoDB 1 1.010 D299261at33208
OrthoFinder 1 1.000 FOG0007390
OrthoInspector 1 1.000 T1088856
orthoMCL 1 0.900 OOG5_134620
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.670

Return to query results.
Submit another query.