DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and Rbm45

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_700454.1 Gene:Rbm45 MGIID:2387367 Length:476 Species:Mus musculus

Alignment Length:495 Identity:178/496 (36%)
Similarity:272/496 (55%) Gaps:75/496 (15%)


  Fly     1 MSDYRSQSRSGGGRGGQEYSNDDDPPMSRLFIICNKAHTEEDFREAFSPYGEIEDIWVVKDKHTQ 65
            |.|......|||.|.|.:  :.|:||.||:|::.:|..:|...||.|||:|:|:|||||:||||:
Mouse     1 MDDAGGLGGSGGFRPGVD--SLDEPPNSRIFLVISKHTSELVLRERFSPFGDIQDIWVVRDKHTK 63

  Fly    66 ENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMD-RTLKVLVAANRNQGSNKSENEQEKYVRLFIVI 129
            |:||:|:|||:::|.|.:|.|||:|:.:|..| :.:||.:|.:|:.||:: :.|.|:..|:|::|
Mouse    64 ESKGVAFVKFARSSQACRAMEEMHGQCLGPSDTKPIKVFIAQSRSSGSHR-DVEDEELTRIFVMI 127

  Fly   130 PKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEP 194
            ||:.||||:||:|..:||:|..:|:|.|..|..||.||||:.|...||.|.|||...::|:.|||
Mouse   128 PKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAIENCDRSFRALLAEP 192

  Fly   195 KGSTRTQRDQYGRPSEDNPLYSSSGRGNSNFNGGGSSSGG-----------GGSNSYNNDWNVSQ 248
            |....      |.|.:|:  |||          |...:.|           |...|..:.::.:.
Mouse   193 KNKVS------GSPEQDD--YSS----------GRQEALGQEPRANLFPFVGEQQSEFSTFDKND 239

  Fly   249 NNDMAAFLRMQNVPVAQPSCLEVNVSNCVNQDQLWRLFDIIPGLDYCQIMREHGPRTNEALVVYD 313
            :....|..:..:|....|          ..::||:.:|||:|||:||::.|:........:|.|.
Mouse   240 SRGQEAVSKRLSVVSRVP----------FTEEQLFSIFDIVPGLEYCEVPRDPYSNYGHGVVQYF 294

  Fly   314 NPEAAIYAKDKLHGLEYPMGERIIVK---------------VNGMSSARMDTSFIDKRTKKDAI- 362
            |..:|||||.||||.:||.|.||:|.               ...|.:|:: .|.:...|.:... 
Mouse   295 NVASAIYAKYKLHGFQYPPGNRIVVSFLDDGSNMTELIRKMATQMVAAQL-ASMVWSTTSQQQFL 358

  Fly   363 --------------CNVPLPPTQPLASPDDQVAQRLFIVLSAN-LPHSILKNIFSCWSGLIDVYL 412
                          .:|.||..:..|.|:..|.:|||:|.:.: ||..:|::||..:..||:|||
Mouse   359 QYGGNAASQAPQIQTDVVLPSCKKKAPPETPVKERLFVVFNPHPLPLDVLEDIFCRFGNLIEVYL 423

  Fly   413 LPNKNCGYVKYAEVESAQLAIRTLNGAEICGTKIKVMEAE 452
            :..||.||||||:.:||..||.||:|..:.|.::|||.|:
Mouse   424 VSGKNVGYVKYADRKSANEAITTLHGKILNGVRLKVMLAD 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 41/81 (51%)
RRM2_RBM45 122..195 CDD:240813 36/73 (49%)
RRM3_RBM45 267..339 CDD:240814 29/72 (40%)
RRM4_RBM45 383..449 CDD:240815 32/67 (48%)
Rbm45NP_700454.1 RRM1_RBM45 23..104 CDD:240812 41/81 (51%)
RRM2_RBM45 120..193 CDD:240813 36/73 (49%)
RRM3_RBM45 248..320 CDD:240814 31/82 (38%)
RRM4_RBM45 393..460 CDD:240815 32/67 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C209031678
eggNOG 1 0.900 E1_2CAJT
Hieranoid 1 1.000
Homologene 1 1.000 H15560
Inparanoid 1 1.050 284 1.000 Inparanoid score I2837
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007390
OrthoInspector 1 1.000 T1085308
orthoMCL 1 0.900 OOG5_134620
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5751
TreeFam 1 0.960
1211.690

Return to query results.
Submit another query.