DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and RBM45

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_016858809.1 Gene:RBM45 HGNCID:24468 Length:617 Species:Homo sapiens

Alignment Length:643 Identity:181/644 (28%)
Similarity:271/644 (42%) Gaps:233/644 (36%)


  Fly     3 DYRSQSRSGGG-RGGQEYSNDDDPPMSRLFIICNKAHTEEDFREAFSPYGEIEDIWVVKDKHTQE 66
            |....|.|||| |.|.:  :.|:||.||:|::.:|...|...||.|||:|:|:|||||:||||:|
Human     2 DEAGSSASGGGFRPGVD--SLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKE 64

  Fly    67 NKGIAYVKFSKTSDAAKAQEEMNGKTIG------------------------------------- 94
            :||||:|||:::|.|.:|.|||:|:.:|                                     
Human    65 SKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVRVPGSGCPRGKEWASWTSLHLLLCRGEG 129

  Fly    95 -----------------------------KM--------------------------DRTL---- 100
                                         |:                          |||.    
Human   130 GVEHPFPAADQTAPGLGTGAALRRGSPPTKLRRVAGKGTGCGVFAPRERTRQPRPPGDRTAVAGL 194

  Fly   101 ------------------------------------------------KVLVAANRNQGSNKSEN 117
                                                            :|.:|.:|:.||:: :.
Human   195 PLSLALTNPPALEFTAKLVLAYFEYFSDLPLSDAQISIYKKRKNSTFPQVFIAQSRSSGSHR-DV 258

  Fly   118 EQEKYVRLFIVIPKTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFEN 182
            |.|:..|:|::|||:.||||:||:|..:||:|..:|:|.|..|..||.||||:.|...||.|.||
Human   259 EDEELTRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAIEN 323

  Fly   183 CSAKYKAVFAEP--KGSTRTQRDQYGR---------------PSEDNPLYSSSGRGNSNFNGGGS 230
            |...::|:.|||  |.|..:::|.|..               |.|....:||..:.:|.      
Human   324 CDRSFRAILAEPKNKASESSEQDYYSNMRQEALGHEPRVNMFPFEQQSEFSSFDKNDSR------ 382

  Fly   231 SSGGGGSNSYNNDWNVSQNNDMAAFLRMQNVPVAQPSCLEVNVSNCVNQDQLWRLFDIIPGLDYC 295
                 |..:.:...:|           :..||              ..::||:.:|||:|||:||
Human   383 -----GQEAISKRLSV-----------VSRVP--------------FTEEQLFSIFDIVPGLEYC 417

  Fly   296 QIMREHGPRTNEALVVYDNPEAAIYAKDKLHGLEYPMGERIIVK-VNGMSSA-----RMDTSFID 354
            ::.|:........:|.|.|..:|||||.||||.:||.|.||.|. ::..|:|     :|.|..:.
Human   418 EVQRDPYSNYGHGVVQYFNVASAIYAKYKLHGFQYPPGNRIGVSFIDDGSNATDLLRKMATQMVA 482

  Fly   355 KRTKKDAICNVP------------------------LPPTQPLASPDDQVAQRLFIVLSAN-LPH 394
            .:. ...:.|.|                        ||..:..|..:..|.:|||||.:.: ||.
Human   483 AQL-ASMVWNNPSQQQFMQFGGSSGSQLPQIQTDVVLPSCKKKAPAETPVKERLFIVFNPHPLPL 546

  Fly   395 SILKNIFSCWSGLIDVYLLPNKNCGYVKYAEVESAQLAIRTLNGAEICGTKIKVMEAE 452
            .:|::||..:..||:|||:..||.||.|||:..||..||.||:|..:.|.::|||.|:
Human   547 DVLEDIFCRFGNLIEVYLVSGKNVGYAKYADRISANDAIATLHGKILNGVRLKVMLAD 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 44/224 (20%)
RRM2_RBM45 122..195 CDD:240813 36/75 (48%)
RRM3_RBM45 267..339 CDD:240814 29/72 (40%)
RRM4_RBM45 383..449 CDD:240815 32/67 (48%)
RBM45XP_016858809.1 RRM1_RBM45 23..101 CDD:240812 39/78 (50%)
RRM <248..>323 CDD:223796 35/76 (46%)
RRM2_RBM45 263..336 CDD:240813 36/73 (49%)
RRM3_RBM45 389..461 CDD:240814 32/97 (33%)
RRM4_RBM45 534..601 CDD:240815 32/67 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C209035306
eggNOG 1 0.900 E1_2CAJT
Hieranoid 1 1.000
Homologene 1 1.000 H15560
Inparanoid 1 1.050 274 1.000 Inparanoid score I2938
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D299261at33208
OrthoFinder 1 1.000 FOG0007390
OrthoInspector 1 1.000 T1075203
orthoMCL 1 0.900 OOG5_134620
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5751
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.700

Return to query results.
Submit another query.