DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1316 and rbm45

Sequence 1:NP_647887.1 Gene:CG1316 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_002935727.1 Gene:rbm45 XenbaseID:XB-GENE-987235 Length:475 Species:Xenopus tropicalis

Alignment Length:529 Identity:178/530 (34%)
Similarity:271/530 (51%) Gaps:120/530 (23%)


  Fly     1 MSDYRSQSRSGGGRGGQEYSNDDDPPMSRLFIICNKAHTEEDFREAFSPYGEIEDIWVVKDKHTQ 65
            |.|......|||        |.:|||.||:|::.:|..||:..||.||.:|:|:||||||||.|:
 Frog     1 MEDSSGFRPSGG--------NLEDPPNSRVFLVVSKYVTEDLIRERFSDFGDIQDIWVVKDKQTK 57

  Fly    66 ENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVAANRNQGSNKSENEQEKYVRLFIVIP 130
            |:||||:||::|:|.|.||.|||:|:.:.:..:.:||.:|.:|...|:: :.|.|:..|:|::||
 Frog    58 ESKGIAFVKYAKSSQACKAMEEMHGRCLSESTKPIKVFIAQSRGSTSHR-DVEDEELTRIFVMIP 121

  Fly   131 KTATEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRFTKFYYAAVAFENCSAKYKAVFAEPK 195
            |:.||||::::|.::|.:|..:|:|.||.|..||..||||.|...||:|.|||...:||:.||||
 Frog   122 KSYTEEDVKQKFKEYGQIEYCSIIKNKNTGESKGLAYVRFLKPSQAALAIENCDRSFKAILAEPK 186

  Fly   196 GSTRTQRDQYGRPSEDNPLYSSSGRGNSNFNGGGSSSGGGGSNSYNNDWN---VSQNN------- 250
                                          |.|| |.||...|.|:|...   :.|::       
 Frog   187 ------------------------------NKGG-SGGGAAENDYHNSARQEAMMQHDHAAAAAT 220

  Fly   251 -----------DMAAFLRMQN------VPVAQPSCLEVNVSNCVNQDQLWRLFDIIPGLDYCQIM 298
                       |.:|..|.|.      :.|::...:         |:|...|||::|||:||::.
 Frog   221 VFPYEYDYASYDKSADARTQETISKRLIVVSRLPLI---------QEQAHNLFDLVPGLEYCEVQ 276

  Fly   299 REHGPRTNEALVVYDNPEAAIYAKDKLHGLEYPMGER-----------------------IIVKV 340
            |:.......|:|.|.|..:|||||.||||.|||.|.|                       :..:|
 Frog   277 RDPYNSFGHAIVQYQNISSAIYAKFKLHGFEYPPGNRLGVSYLNDGGDGSELLRKMASQMVAAQV 341

  Fly   341 NGM---SSARMDT---------SFIDKRTKKDAICNVPLPPTQPLASPDDQVAQRLFIVLSAN-L 392
            :.|   ||....|         |.:..:.:.||    .:|..:..|..|.|..:|||||.:.: |
 Frog   342 SSMVWGSSQHYPTAPPYERPYASPVTSQLQTDA----AIPSVKKKAPSDAQSKERLFIVFNPHPL 402

  Fly   393 PHSILKNIFSCWSGLIDVYLLPNKNCGYVKYAEVESAQLAIRTLNGAEICGTKIKVMEAEERSGS 457
            |..:::::|..:..||:||::|.||.||.:||::.||..||..|:|..:.|.|:|||:|:    |
 Frog   403 PLDVMEDVFCRFGNLIEVYIVPGKNVGYARYADLSSANDAIAVLHGKMVNGVKLKVMQAD----S 463

  Fly   458 DGDDGGRKR 466
            ..|:..:::
 Frog   464 PRDESNKRQ 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 41/80 (51%)
RRM2_RBM45 122..195 CDD:240813 35/73 (48%)
RRM3_RBM45 267..339 CDD:240814 29/95 (31%)
RRM4_RBM45 383..449 CDD:240815 29/67 (43%)
rbm45XP_002935727.1 RRM1_RBM45 17..97 CDD:240812 41/80 (51%)
RRM2_RBM45 113..186 CDD:240813 35/73 (48%)
ELAV_HUD_SF 120..458 CDD:273741 118/382 (31%)
RRM3_RBM45 245..317 CDD:240814 30/81 (37%)
RRM4_RBM45 392..459 CDD:240815 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C209034821
eggNOG 1 0.900 E1_2CAJT
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H15560
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D299261at33208
OrthoFinder 1 1.000 FOG0007390
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.