DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and Fndc1

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_006523412.1 Gene:Fndc1 MGIID:1915905 Length:1833 Species:Mus musculus

Alignment Length:534 Identity:119/535 (22%)
Similarity:179/535 (33%) Gaps:202/535 (38%)


  Fly   214 QNILSVEEYIKESLF------LETSAAK---------SLYRSLRLDTESVEIKRIMDEQVVRSAA 263
            |::.:.||...|.:.      |.||..|         :.|....||.:...|.:::.|:      
Mouse  1117 QSVFTEEEEENEGILKGKEDSLSTSVKKWPSSSSPRNNKYADRNLDRDKAAIGQLVQEE------ 1175

  Fly   264 ILKEAQTVPTSQTQLEKRLMKKGSTPATPPVHPKPNPNTTPKPKNPLLRSHSAD---------EE 319
                 .::|..:            :|.:||:  ..:|.|..:|:||:..|.||.         ..
Mouse  1176 -----DSIPGRR------------SPGSPPI--ASHPPTWYQPRNPVTASPSASTHSWPRYTTRA 1221

  Fly   320 PDIDVENAPVI------QGSFEGSFEITKTDADIARKKTPP---TRAYQAASS---TLPPKAIAV 372
            |.......|::      |..|.         ..::|:..|.   |..|...::   .:||.:|..
Mouse  1222 PSTYSSTTPMLSLRQRMQRRFR---------TPVSRQPPPRPVLTSGYNGRANVGENIPPGSIGK 1277

  Fly   373 -------------------------------------TPFSLRVKPKKPSIEKL---TTVLPQQL 397
                                                 .|..:|:.....:|..|   ..|.|..|
Mouse  1278 PNGQRIINGPQGTKWVVDLDRGLVLNAEGRYLQDSHGNPLRVRLGGDGRTIVDLGGTPMVSPDGL 1342

  Fly   398 PT------GGPISSTR---------------ATTKATKATTTTTKRTTTSTTRKTTTTTTPKPTT 441
            |.      |.|::|.:               ...|.|..:.|||...||:||...||||.| |||
Mouse  1343 PLFGQGRHGKPVASAQDKPILSLGGKPLVGLEVIKTTTYSPTTTMLPTTTTTTVLTTTTRP-PTT 1406

  Fly   442 TTTTTEATTTTTTSTTTTTPPLPPSTTRATTTSTNTFTYPSVNTPPPN-QGGSLPKLD--ANLFT 503
            |||||..|||..|:||..    |.:|.|||..:|.|.|.|...||.|. ..|:|...|  .||  
Mouse  1407 TTTTTRRTTTRRTTTTRH----PTTTIRATRRTTTTTTTPEPTTPSPTCPPGTLEHQDEAGNL-- 1465

  Fly   504 TFPILDTQPWRPMHREVPELLP------------GPP------------------PAFPTKTLPG 538
               |:.:       ..:||..|            .||                  |  ||.|:|.
Mouse  1466 ---IMGS-------NGIPECYPEEDDFSGLETDTAPPTEEDYVVYDDDYGFETTRP--PTSTMPS 1518

  Fly   539 GTTPTVNHIPQRRI------DEFEL-----------PFIADNPTPPTAAVAPVTVDPYSLGFLNP 586
            .|..|...||::..      :||:|           .:::.:||.|.:...  .:|.:.:..|:.
Mouse  1519 TTAATPKVIPEQGTVSSFPEEEFDLAGKRRFVAPYVTYLSKDPTAPCSLTD--ALDHFQVESLDE 1581

  Fly   587 GLRVQEPKPNLGPQ 600
            .:.....|.:|.||
Mouse  1582 LIPNDLTKSDLPPQ 1595

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
Fndc1XP_006523412.1 FN3 37..117 CDD:214495
FN3 155..238 CDD:214495
FN3 258..351 CDD:238020
FN3 359..449 CDD:238020
FN3 1597..1688 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.