DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and abi3bp

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:NP_001025691.1 Gene:abi3bp XenbaseID:XB-GENE-951329 Length:1516 Species:Xenopus tropicalis

Alignment Length:1085 Identity:229/1086 (21%)
Similarity:353/1086 (33%) Gaps:358/1086 (33%)


  Fly    30 SADYTYQNTVGRRSQLGAYYHMNKQPSYTN----EHSLNSQYGYNTWGIWRDGRNIAPSTFSAKT 90
            ||:.|::.|..:.|        .||.:..|    |..||.....:|    .:|..|.|||.:  :
 Frog   438 SANITWKTTEEQTS--------TKQVTGINEPYTEDDLNITENQDT----GNGLPIVPSTLT--S 488

  Fly    91 HTQYPKNRSFSIILT---------------TAAFIVLLTVI-----SIA-----------GLAFY 124
            |.:..|.....|:||               |:|..:..|.:     |:.           .::.|
 Frog   489 HLEITKKMPALIMLTSSKQGLPLVSSTLSPTSAVTMKKTPVPEDPTSLTQEMFPASPDDRQVSLY 553

  Fly   125 --FSSIKTNLEDP------------------VMGFEGSFRIAKGDLFSTGLKYNHTTT-YKQKID 168
              |..::|.:..|                  :.|.:.|..:|:....|:.|....|.. .||:..
 Frog   554 TPFQQLRTTMGLPLIPTTSSPILDLTMKITRISGVQTSTSLAENFPESSDLPQQSTNVPLKQQRT 618

  Fly   169 FYKRFVERSMMDNGLQP------LRTDVWGFGDGPLIKVSFRVFLDV------------------ 209
            ........|..|..:.|      |||.: |.   |||..:...|||:                  
 Frog   619 TLAEMFPTSPDDRQVSPYTPFQQLRTTM-GL---PLIPPTSSPFLDLTMKITSIPGVQLSTSLAE 679

  Fly   210 -----RKLPQNI--------LSVEEYIKESLFLETSAAKSLYRSLRLDTESVEIKRIM------- 254
                 ..|||..        .::.|.:.||..:..::...|:...| .||:.:.|:.|       
 Frog   680 NFPESSDLPQQSTNMPLKQRTTLAEIVPESTDVPQASTDKLHTHYR-TTEATKDKQSMYIPATIS 743

  Fly   255 ---DEQVVRSAAILKEAQTVP----TSQTQLEKRLMKKGSTPATP--------PVHP-------- 296
               :||....::|.....:.|    |:...:|  |:|....|..|        ||.|        
 Frog   744 SLENEQTPHESSIHSGIYSSPLFQNTASPSVE--LVKSLPVPTNPHHFAKTEVPVVPHEIPYLQT 806

  Fly   297 -KPNPNTTPKPKNPLLRSHSADEEPDIDVENAPVIQGSFEGSFEITKTDAD-------IARKKTP 353
             ||:|:|    :.|.:.|.|.....:......|.|   ||....:..|:..       :::.:|.
 Frog   807 SKPSPST----EAPRMESDSTQSVSETITTEVPHI---FEQEKVVATTEEQYVQELGAVSKPETK 864

  Fly   354 PTRAY-----------------QAASSTLPPKAIAVTPFSL-RVKPKK----------------- 383
            ||..:                 |.:||...||....|...| :..||:                 
 Frog   865 PTTVFKETQAINVVEEARTTEVQMSSSPSAPKETLATEKPLPKFDPKETHHVPINVIRLHIFGDP 929

  Fly   384 -PSIEKLTT---VLPQQLPTGGPISSTRATTKATK---------------ATTTTTKRTTTSTTR 429
             |:|:  ||   :.|:...|....|||.|.|...|               ||..:...||:|.|.
 Frog   930 NPTID--TTEKSISPKPRATTESPSSTAAPTTMKKMPIHIIKLHIFDNPEATAPSENLTTSSPTP 992

  Fly   430 KTTTTTT-------PKPTTTTTTTEAT-------TTTTTSTTTTTPPLPPSTTRATTTSTNTFTY 480
            |||...|       ||||......:.:       ..:..|.|...||||.:|.||.|..|.    
 Frog   993 KTTQPHTISQSKPAPKPTQRVPINDISHQLYGDPEVSLVSNTARPPPLPKTTQRAETPQTK---- 1053

  Fly   481 PSVNTPPPNQGGSL----PKLDANLFTTFPILDTQPWRPMHREVP--ELLPGPPPAFPTKTLPGG 539
                 |.||:...:    ||.        |....||.:|...|.|  .:.|..||..|..|.   
 Frog  1054 -----PVPNETRKVFPYKPKK--------PQPTAQPRKPASTEAPGDSIKPKIPPQTPEATF--- 1102

  Fly   540 TTP-TVNHIPQRRIDEFELPFIADNPTPPTAAVAPVTVDPYSLGF-LNPGLRVQEPKPNLGPQAQ 602
             .| .:.|..||               |.|           |:|. :|||.|:.:....||....
 Frog  1103 -APYKLQHSSQR---------------PRT-----------SVGSRINPGGRLYDRSKLLGVSRN 1140

  Fly   603 -----DQDMLFYHNFGSPIFMPGTENIERLGGALVEPHPLPVPLIDDVIIPPFKPIDA---TMGT 659
                 :..:...::..|..|:|....|.|.     .||...|......::.|..|..|   ....
 Frog  1141 ISVEVNTTIRRTYSVSSAPFLPVQPTIMRR-----RPHATNVTGRPGSVLMPRAPSTARPNRTAV 1200

  Fly   660 GDKMPFNLDASNERFEHLGGGVIAKKPQEKLEKKE-QPSKKEQLEAHVKEANQTAPEKKKAQAHN 723
            ..|.|....||.|             |::.:|... .|:.|.:::| :.:...|.|.        
 Frog  1201 SIKAPIPSSASPE-------------PEDTVEATVFSPTPKSEIDA-LGKIRTTGPH-------- 1243

  Fly   724 DQKADQPEITTKVERKQE---------KVEVTTLATNVPVKSSPKPTKSPSLPSLKPTDNSVLAD 779
                     .|.:.:|||         |...|..|||..:.|.|          :.|..|..:..
 Frog  1244 ---------ITYMTKKQEHPCSITESLKYFPTEEATNQEIVSRP----------MNPPSNLTIVT 1289

  Fly   780 TIGEFFMELLNLPKEENATATKKPIEDAIESRIEPEEEESLDTLKA--PSVSLSKPNFMNLKEII 842
            ..|.....:|:....||.|.|:..| .:.|:...|.:::|:.|...  .:|...||| .:.:.::
 Frog  1290 VEGCPSFVILDWQPPENDTVTEYKI-ISTENGAPPGKDQSIITTNQTFQTVENLKPN-ASYQFLV 1352

  Fly   843 LQRNTPSSILSNETLEESTTTTMPTTTTRTTTEEPRTTKRNRIRT 887
            :..|......::.|:|.||.:..|..:      ||.|..::.|.|
 Frog  1353 IPTNPLGEGPASNTVEFSTESADPRVS------EPVTGGKDAIWT 1391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
abi3bpNP_001025691.1 FN3 115..191 CDD:214495
FN3 1280..1371 CDD:238020 21/93 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.