DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and TMPRSS15

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_011527956.1 Gene:TMPRSS15 HGNCID:9490 Length:1064 Species:Homo sapiens

Alignment Length:786 Identity:147/787 (19%)
Similarity:226/787 (29%) Gaps:264/787 (34%)


  Fly    82 APSTFSAKTHTQYPKN--RSFSIILTTAAFIVLLTVISIAGLAFYFSSIKTNLEDP-VMGFEGSF 143
            |.:||...:...|..|  ...|:.....||.:...:..|    |..|::|...::. |:.|:.::
Human    58 ARATFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEI----FLSSNLKNEYKNSRVLQFDKNW 118

  Fly   144 RIAKGDLFSTGLKYNHTTTYKQKIDFYKRFVERSMMDNGLQPLRTDVWGFGDGPLIKVSFRVFLD 208
            |.|:.::.||...|:          .|..::.:....||               .|.|.|.:|  
Human   119 RQAENEVESTVSLYS----------LYGSWIHQKYQKNG---------------SIIVVFDLF-- 156

  Fly   209 VRKLPQNILSVEEYIKESLF--LETSAAKSLYRSLRLDTESVEIKRIMDEQVVRSAAILKEAQTV 271
               ..|.:  .:|.:||.|.  ||.:.:..|. :..:|..||:|           .|.|:...||
Human   157 ---FAQWV--SDENVKEELIQGLEANKSSQLV-TFHIDLNSVDI-----------LASLENFSTV 204

  Fly   272 PTSQTQLEKRLMKKGSTPATPPVHPKPNPNTTPKPKNPLLRSHSADEEPDIDVENAPVIQGSFEG 336
            ..:.|..:.......:||....:...|..:    |....|....||...|.:| |.|      :|
Human   205 SPATTSDKLTTTSHLATPGNVSIECLPGSS----PCTDALTCIKADLFCDGEV-NCP------DG 258

  Fly   337 SFEITKTDADIARKK---TPPTRAYQAASSTLPPKAIAVTPFSLRVKPK---KPSIEKLTTVLPQ 395
            |.|..|..|.:...:   |..:.::||.....|.:...|..:.:||...   |.|.:...|....
Human   259 SDEDNKMCATVCDGRFLLTGSSGSFQATHYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTD 323

  Fly   396 QLPTGGPISSTRATTKATKATTTTTKRTTTSTTRKTTTTTTPKPTTTTTTTEATTTTTTSTTTTT 460
            .|.....:.|::..            |.:...|...|........|.|...|:..:.......  
Human   324 ILDIYEGVGSSKIL------------RASIWETNPGTIRIFSNQVTATFLIESDESDYVGFNA-- 374

  Fly   461 PPLPPSTTRATTTSTNTFTYPSVNTPPPNQGGSLPKLDANL-----FTTFPILDTQPWRPMHREV 520
                              ||.:.|:...|   :..|::.|.     |....:.|...|..:....
Human   375 ------------------TYTAFNSSELN---NYEKINCNFEDGFCFWVQDLNDDNEWERIQGST 418

  Fly   521 PELLPGP--------PPAF--PTKTLPGGTTPTVNHIPQRRIDEFELPFIADNPTPPTAAVAPVT 575
            .....||        ...|  .|.|.|||.        |.|:....||.   :|          |
Human   419 FSPFTGPNFDHTFGNASGFYISTPTGPGGR--------QERVGLLSLPL---DP----------T 462

  Fly   576 VDPYSLGFLNPGLRVQEPKPNLGPQAQDQDMLFYHNFGS-----PIFMPGTENIERL-------- 627
            ::|..|.|                        :||.:|.     .|.:...:|:|:.        
Human   463 LEPACLSF------------------------WYHMYGENVHKLSINISNDQNMEKTVFQKEGNY 503

  Fly   628 ---------------------------------------------GGALVEPHPLPVPLIDDVII 647
                                                         |....||..:|.|       
Human   504 GDNWNYGQVTLNETVKFKVAFNAFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTP------- 561

  Fly   648 PPFKPIDATMGTGDKMPFNLDASNERFEHLGGGVIAKKPQEKLEKKEQPSKKEQLEAHVKEANQT 712
            ||..|.|.                      ||.....:|.........|:....|...|...|  
Human   562 PPELPTDC----------------------GGPFELWEPNTTFSSTNFPNSYPNLAFCVWILN-- 602

  Fly   713 APEKKKAQAHNDQKADQPEITTKVE-RKQEKVEVTTLATNVPVKSSPKPTKSPSLPSLKPT---- 772
            |.:.|..|.| .|:.|...|...|| |..|:.:...||    |.:.|.|.|.....:.:.|    
Human   603 AQKGKNIQLH-FQEFDLENINDVVEIRDGEEADSLLLA----VYTGPGPVKDVFSTTNRMTVLLI 662

  Fly   773 DNSVLA 778
            .|.|||
Human   663 TNDVLA 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
TMPRSS15XP_011527956.1 SEA 53..195 CDD:214554 38/185 (21%)
LDLa 229..263 CDD:238060 12/45 (27%)
CUB 270..376 CDD:278839 19/138 (14%)
MAM 387..547 CDD:214533 28/205 (14%)
MAM 392..547 CDD:99706 27/200 (14%)
CUB 569..676 CDD:278839 29/130 (22%)
LDLa 688..722 CDD:238060
SR 723..816 CDD:214555
Tryp_SPc 829..1059 CDD:214473
Tryp_SPc 830..1061 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BGTX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.