DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and Abi3bp

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_017453608.1 Gene:Abi3bp RGDID:1562717 Length:1596 Species:Rattus norvegicus

Alignment Length:1166 Identity:236/1167 (20%)
Similarity:371/1167 (32%) Gaps:397/1167 (34%)


  Fly   211 KLPQNI-LSVEEYIKESLFLETSAAKSLYRSLRLDTESVEIKRIMDEQV---------------- 258
            |||.:| |.:.:.:|..|      ||:...:|..::::.|::::..:.|                
  Rat   287 KLPSSIMLEISDALKAQL------AKNETLALPAESKTPEVEKVAGQPVTVTPETVSRSTKPTLA 345

  Fly   259 -----VRSAAILKEAQTVPTSQTQL--EKRLMKKGSTPATPPVHPKPNPNTTPKPKNPLLRSHSA 316
                 ..:|.:|.| :|..|:|:.|  |..|:.....|...|..|:..   |..|......|.::
  Rat   346 SALDTAETALVLSE-KTPETAQSVLIPESELLLSSLAPKGSPEFPEAK---TAFPSEKPGGSLAS 406

  Fly   317 DEEPDIDVENAPVIQGSFEGSFEITKTDADIARKKTPPTRAYQAASSTLPPKAIAVTPFSLRVKP 381
            .|||       .|:.|:        ||..| :|...|.|..|...||:.......|.|.:....|
  Rat   407 SEEP-------WVVPGA--------KTSED-SRVVQPRTATYDVVSSSATSDETEVEPHTATSDP 455

  Fly   382 KKPSIEKLTTVLPQQLPTGGPISSTRATTKATKAT---------TTTTKRTTTSTTRKTTT---- 433
            ...|:...|:...:|         .|||...::|:         |:...|.||:..::||:    
  Rat   456 ILDSVPPKTSRTAEQ---------PRATLAPSEASFDPRTVEIFTSPEVRPTTAAPQQTTSIPST 511

  Fly   434 ---TTTPKPTTTTTTTEATTTTTTSTTTTTP--PLPPSTTRATTTSTNTFTYPSVNTPPPNQGGS 493
               .:||||.......|..|..:..:|...|  ...|...|..||.:            |....|
  Rat   512 PKRQSTPKPPRVKPAPEPETRPSAQSTKAPPHKTKKPGRRRPKTTRS------------PEVPKS 564

  Fly   494 LPKLDANLFTTFP-------ILDTQPWRP---MHREVPELLPGPPP------------------- 529
            .|.|:.   .|.|       |:...|.||   ...|.|::.|...|                   
  Rat   565 KPALEP---ATVPPEILVPTIVPKPPQRPKATRRPEAPQIQPAHEPVTFGSEAPALAIVTTTDIA 626

  Fly   530 -------AFPTKTLPGGTTPTVNHIPQRRIDEFELPFIADNPTP-----PTAAVAPVTVDPYSLG 582
                   |..|...|..:.|.....|:.:.          .|:|     ..|.:.|:|.:| ||.
  Rat   627 PVISRTKASVTTLAPKSSRPRTRQRPKYKA----------TPSPKIPQTKPADLGPITAEP-SLA 680

  Fly   583 FLNPGLRVQEPKPNLGPQAQ-DQDMLFYHNFGSPIF---MPGTENIERLGGALVEPHPLP----- 638
            .....:|...|||...|..: .|.:|.......|:.   .|||..:.:|......|||.|     
  Rat   681 STTKKVRRPRPKPKTTPHPEVPQTILVPATSLEPVIRTETPGTTLVPKLSQQPDFPHPKPKTTRS 745

  Fly   639 -----------------VPLIDDVI--IPPFKPIDATMGTGDKMPFNLDASNERFEHLGGGVIAK 684
                             :||.:|.:  |.||..::........:.|..:|....       :.:|
  Rat   746 PAAPPTELVSTTVFEPVIPLKEDPVTTIVPFTDLEPATDLETPVAFRTEAPRTT-------LASK 803

  Fly   685 KPQEKLEKKEQPSKKEQLEAHVKEANQTAPEKKKAQAHNDQKADQPEITTKVERKQEKVEVTTLA 749
            |.|.....:.:|.|        ...:..||:.|..          |.:..:....:.:|:|||||
  Rat   804 KSQRTRRPRPRPPK--------ATLSPQAPKTKTV----------PAVVLEPVTLRPEVQVTTLA 850

  Fly   750 TNVPVKS--------SPKPTKSPSLPSLKPTDNSVLADTIGEFFMELLNLPKEENATATKKPIED 806
               |.|:        .|||..||.:...||.....         .|.:.| :.|:...||.|...
  Rat   851 ---PKKTQIKHRPRPKPKPIPSPEVAESKPVPTKE---------REPVTL-RTESWVTTKAPKTP 902

  Fly   807 AIESRIEPEEEESLDTLKAPSVSLSKP-NFMNLKEIILQRNTPSSILSNETLEEST-TTTMPTTT 869
            ....|:.|:.:.:     .|...|:|| ...:|:...|....|::::....|..:| .|..|.||
  Rat   903 KRTHRVRPKPKTT-----TPEAPLTKPVAATDLESSALSTEVPTTVVLTTALVPATLRTKSPKTT 962

  Fly   870 -------TRTTTEEPRTTKRNRI---------------------RTTSERPTMMDDSNLFPSHSK 906
                   ||.....|:||.|..:                     :|.:.|.|......|.|.||:
  Rat   963 LAPSVQRTRRPRPRPKTTARTDVSESKSVSDDLELVAFSTESPQKTIAPRQTTSPPPKLKPPHSR 1027

  Fly   907 WEFVNSSSAQGFGHNSNMRKVFNQTLQAWVSEDIDKSENLTLNDIKTRINNASNIQDISLIFDTL 971
            ..                           ..|.:.|....|.:  |.::..:..:.||:      
  Rat  1028 RP---------------------------AKEQVPKGSLHTTS--KPKMPPSPEVVDIT------ 1057

  Fly   972 ASKLGITPSVPNKFPPFSQNKLKHAPKEEVTRR-----PI------PSST-----TTEIPLLIPE 1020
                    |||      ...:|.|.|..||::.     |:      |.:|     |.:|||:...
  Rat  1058 --------SVP------KDEQLSHKPDPEVSQSETVLPPVTFRVEPPKTTIVPLETRDIPLIPVI 1108

  Fly  1021 SILPVEREPFIKPMSSFIDDGSSEVLGAAIPVIGEAEVEVVDPLNYEEMLKISQFAASSTEPSVH 1085
            |..|.|.|  ::......|..:.|:....||                   :.::.|.::..|  |
  Rat  1109 SPRPSEEE--LQTTMEQTDQSTQELFTTKIP-------------------RTTELAKTTQAP--H 1150

  Fly  1086 KLVTLLPVRSNSGIRTYRPPAADEETQR------------------SASAPAPLA---------- 1122
            :|.| .|||.....|.:..||.::.|.|                  :...|.|.:          
  Rat  1151 RLHT-TPVRPRIPERPHGRPALNKTTTRPDRTKSRGMSHKNGVGPGTKQTPKPSSTGRNTSVDSH 1214

  Fly  1123 ----------------APAPAP---APLP-----GKISIRRKSNLNQSRRFGQPPAEAVVK 1159
                            :|.|.|   .|||     ||..   .:.:..|.|...||.:|.:|
  Rat  1215 ATRKPGLIPGTRHRHTSPRPVPPQRKPLPPNNVTGKPG---SAGIISSSRATSPPLKATLK 1272



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23197
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.