DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and Abi3bp

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_006522314.1 Gene:Abi3bp MGIID:2444583 Length:1638 Species:Mus musculus

Alignment Length:1019 Identity:211/1020 (21%)
Similarity:330/1020 (32%) Gaps:344/1020 (34%)


  Fly   246 ESVEIKRIMDEQVVRSAAILKEAQTVPTSQTQLEKRLMKKGSTPATPPVHPKPNPNTTP------ 304
            ||..::.....:|..:.|..::..::|::.        |:.|||..|.|.|.|.|.|.|      
Mouse   481 ESRNVEIFTSPEVRPTTAAPQQTTSIPSTP--------KRQSTPKPPRVKPAPEPETRPSAQTTK 537

  Fly   305 ------KPKNPLLRSHSADEEPDIDVENAPVIQGSFEGSFEITKTDADIARKKTPPTRAYQAASS 363
                  ||.:..||.......|::. ::.|.::                     |.|        
Mouse   538 APRKTKKPGHHRLRRPKTTRSPEVP-KSKPALE---------------------PAT-------- 572

  Fly   364 TLPPKAIAVTPFSL--RVKPKKPSIEKLT--TVLPQQLPTGGPISSTRATTKATKATTTTTKRTT 424
                    |||..|  ::.||.|...|.|  ..:||..|...|: :..:...|....|||.....
Mouse   573 --------VTPEILVPKIVPKPPQKPKATRRPEVPQVKPAHEPV-TFGSEAPALAIVTTTDIEPV 628

  Fly   425 TSTTRKTTTTTTPKPTTTTTTTEATTTTTTST-------------TTTTPPLPPSTTRATTTSTN 476
            .:.|:.:.||..|||....|..:.|...||.:             .|:.|||      |:||.  
Mouse   629 ITRTKASVTTLAPKPPRPRTHRQRTKYKTTQSPKIPHSKPADLGPITSEPPL------ASTTK-- 685

  Fly   477 TFTYPSVNTPPPNQGGSLPKLDANLFTTFPILDTQPWRPMHREVPELLPGPPPA---FPTKTLPG 538
                 .|..|.|                      :|....|.|||..:..|..:   |.....||
Mouse   686 -----KVRRPRP----------------------KPQTTPHPEVPHTILVPATSLEPFIITEAPG 723

  Fly   539 GTTPTVNHIPQRRIDEFELPFIADNPTPPTAAVAPVTVDPYSLGFLNPGLRVQEPKPNLGPQAQD 603
              |..|..:||:          .|.|.|                         :||....|.|..
Mouse   724 --TTLVPKLPQQ----------PDYPHP-------------------------KPKTTRSPAASP 751

  Fly   604 QDMLFYHNFGSPIFMPGTENIERLGGALVEPHPLPVPLIDDVI--IPPFKPIDATMGTGDKMPFN 666
            .:::     .:|:|.|.|                  ||.:|.:  |.|...::........:.|.
Mouse   752 TELV-----PTPVFEPVT------------------PLKEDPVTTIVPITDLERVTDLETPVAFR 793

  Fly   667 LDASNERFEHLGGGVIAKK---------PQEKLEKKEQPSKKEQLEAHVKEANQTAPEKKKAQAH 722
            .:|.        |..:|.|         |:.:...:.:|..|..|       :..|||.|..   
Mouse   794 TEAP--------GTTLASKISQRTHRPRPRPRPRPRPRPRPKATL-------SPQAPETKTV--- 840

  Fly   723 NDQKADQPEITTKVERKQEKVEVTTLATNVPVKS-----SPKPTKSPSLPSLKPTDNSVLADTIG 782
                   |.:..:....:.:|:|||||.....|.     .|||..||.:...||....|      
Mouse   841 -------PAVVLEPVTLRPEVQVTTLAPQKTQKKHRPSPKPKPVPSPEVTESKPVLPRV------ 892

  Fly   783 EFFMELLNLPKEENATATKKPIEDAIESRIEPEEEESLDTLKAPSVSLSKP-NFMNLKEIILQRN 846
               .|.:.| :.|....||.|.......|..|:.:    |...|...|:|| ...:|:...|...
Mouse   893 ---REPVTL-RTETWVTTKAPKTPKRTRRPRPKPQ----TTPTPETPLTKPVAATDLEPSALSTE 949

  Fly   847 TPSSILSNETLEESTTTTMPTTTTRTTTEEP--RTTKRNRIRTTSERPTMMDDSNLFPSHSKWEF 909
            .|::::....|   |..|:.|...:|||..|  :.|:|...|..:...|.:.:|...|:.     
Mouse   950 VPATVVLATAL---TPVTLRTKAPKTTTLAPNVQRTRRPHPRPKTTASTGVSESKSAPTE----- 1006

  Fly   910 VNSSSAQGFGHNSNMRKVFNQTLQAWVSEDIDKSENLTLNDIKTRINNASNIQDISLI-FDTLAS 973
                                  ||:.|.:.: .|.:|.:      |.:.|...|:.|: |.|.:.
Mouse  1007 ----------------------LQSLVLKPV-TSPSLEI------IQSQSVSDDLELVAFSTESP 1042

  Fly   974 KLGITPSVPNKFPPFSQNKLK--HA---PKEEVTRRPI---------PS---STTTEIPLLIPES 1021
            :..|.|......||    |||  |:   .||.|.:.|:         ||   :.||.:|.....|
Mouse  1043 QKTIAPRQTTSMPP----KLKTPHSRMPAKEPVPKEPLHTTSKPKMPPSPEVADTTSVPKDERLS 1103

  Fly  1022 ILP----VEREPFIKPMSSFIDDGSSEVLGAAIPVIGEAEVEVVDPLNYEEMLKISQFAASSTEP 1082
            :.|    ...|..:.|::..::...:.:  |.:...|...:.|:.|...:|.|   |.|...|:.
Mouse  1104 LKPDPEVTHSETVLPPVTFRVEPPKTTI--APLETRGIPLIPVISPRPSQEEL---QTAMEETDQ 1163

  Fly  1083 SVHKLVT--------------------LLPVRSNSGIRTYRPPAADEETQR-------------- 1113
            |..:|.|                    ..|||.....|.:..||.::.|.|              
Mouse  1164 STQELFTTKIPRTTELAKTTQAPHRLHTAPVRPRIPGRPHGRPALNKTTTRPDKTKPRGTSHKNG 1228

  Fly  1114 ----SASAPAPLAAPAPAPAPLPGKISIRRKSNLNQSRRFGQPP 1153
                :..||.|   |:|.........:.|:..:::.:||   ||
Mouse  1229 VGTGTKQAPKP---PSPGRNASVDSHATRKPGSVSGTRR---PP 1266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
Abi3bpXP_006522314.1 fn3 116..204 CDD:278470
FN3 1402..1493 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.